Hemoglobin A1 Antibody (1R1N7)

Novus Biologicals | Catalog # NBP3-16804

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1R1N7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin A1 (HBA1) (P69905). MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hemoglobin A1 Antibody (1R1N7)

Western Blot: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804]

Western Blot: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804]

Western Blot: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Analysis of extracts of Rat liver, using Hemoglobin A1 (HBA1) Rabbit mAb (NBP3-16804) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804]

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804]

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunofluorescence analysis of mouse spleen using Hemoglobin A1 (HBA1) Rabbit mAb (NBP3-16804) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804]

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804]

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunofluorescence analysis of rat spleen using Hemoglobin A1 (HBA1) Rabbit mAb (NBP3-16804) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Hemoglobin A1 Antibody (1R1N7)

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] -

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Hemoglobin A1 Antibody (1R1N7)

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] -

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Hemoglobin A1 Antibody (1R1N7)

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] -

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Hemoglobin A1 Antibody (1R1N7)

Immunocytochemistry/ Immunofluorescence: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] -

Immunocytochemistry/ Immunofluorescence: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunofluorescence analysis of paraffin-embedded human spleen using Hemoglobin A1 (HBA1) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Hemoglobin A1 Antibody (1R1N7)

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] -

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Hemoglobin A1 Antibody (1R1N7)

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] -

Immunohistochemistry: Hemoglobin A1 Antibody (1R1N7) [NBP3-16804] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Hemoglobin A1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Applications for Hemoglobin A1 Antibody (1R1N7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hemoglobin A1

The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported.

Alternate Names

alpha one globin, alpha-1 globin, alpha-1-globin, alpha-globin, CD31, hemoglobin alpha 1 globin chain, Hemoglobin alpha chain, hemoglobin alpha-1 chain, hemoglobin subunit alpha, hemoglobin, alpha 1, MGC126895, MGC126897

Gene Symbol

HBA1

Additional Hemoglobin A1 Products

Product Documents for Hemoglobin A1 Antibody (1R1N7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hemoglobin A1 Antibody (1R1N7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hemoglobin A1 Antibody (1R1N7)

There are currently no reviews for this product. Be the first to review Hemoglobin A1 Antibody (1R1N7) and earn rewards!

Have you used Hemoglobin A1 Antibody (1R1N7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...