HINT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86024

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HINT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube, gastrointestinal, kidney and testis using Anti-HINT2 antibody NBP1-86024 (A) shows similar protein distribution across tissues to independent antibody NBP2-56156 (B).
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024]

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
HINT2 Antibody - BSA Free Western Blot: HINT2 Antibody - BSA Free [NBP1-86024]

Western Blot: HINT2 Antibody - BSA Free [NBP1-86024]

Analysis in human cell line PC-3.
HINT2 Antibody - BSA Free

Western Blot: HINT2 Antibody - BSA Free [NBP1-86024] -

HINT2 attenuates hepatic steatosis, inflammation, fibrosis and mitochondrial damage in MASH mice.a WT and Hint2−/− mice were fed a WDSW for 24 weeks. b Body weights of the mice. c Serum liver enzymes of the mice. d H&E and Oil Red O staining (scale bars, 100 μm) of mouse liver sections. e Intrahepatic TG contents of the mice. f mRNA levels of Hint2, Cpt1a, Acaca and Fasn in mouse livers. g Protein levels of total and phosphorylated ACC in mouse livers. h Serum MCP-1 concentrations of in mice. i mRNA levels of Ccl2, Il8 and Tnfa in mouse livers. j Sirius Red and alpha -SMA staining (scale bars, 100 μm) of mouse liver sections. k mRNA levels of Col1a1 and Acta2 in mouse livers. l TEM (scale bars, 2 μm) of mouse liver sections. Data are presented as mean +/- s.d. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001 (Student’s t-test). Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s12276-025-01445-w), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HINT2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: HINT2 Antibody [NBP1-86024]

Immunocytochemistry/ Immunofluorescence: HINT2 Antibody [NBP1-86024]

Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for HINT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HINT2

Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM]

Alternate Names

EC 3.-, HINT-2, HINT-3, histidine triad nucleotide binding protein 2, histidine triad nucleotide-binding protein 2, mitochondrial, HIT-17, HIT-17kDa, PKCI-1-related HIT protein, protein kinase C inhibitor-2

Gene Symbol

HINT2

Additional HINT2 Products

Product Documents for HINT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HINT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HINT2 Antibody - BSA Free

Customer Reviews for HINT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HINT2 Antibody - BSA Free and earn rewards!

Have you used HINT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...