HLA DRA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38691

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HLA DRA Antibody - BSA Free

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining in human lymph node and skeletal muscle tissues. Corresponding HLA-DRA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human liver shows positivity in Kupffer cells.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human lymph node shows membranous positivity in lymphoid cells.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human small intestine shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-HLA-DRA antibody (A) shows similar protein distribution across tissues to independent antibody (B).
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human colon using Anti-HLA-DRA antibody.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human cerebral cortex using Anti-HLA-DRA antibody.
Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691]

Immunohistochemistry-Paraffin: HLA DRA Antibody [NBP2-38691] - Staining of human kidney using Anti-HLA-DRA antibody.

Applications for HLA DRA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA DRA

HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5.

Alternate Names

FLJ51114, histocompatibility antigen HLA-DR alpha, HLA class II histocompatibility antigen, DR alpha chain, HLA-DRA1, major histocompatibility complex, class II, DR alpha, MHC cell surface glycoprotein, MHC class II antigen DRA, MLRW

Gene Symbol

HLA-DRA

UniProt

Additional HLA DRA Products

Product Documents for HLA DRA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HLA DRA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HLA DRA Antibody - BSA Free

Customer Reviews for HLA DRA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HLA DRA Antibody - BSA Free and earn rewards!

Have you used HLA DRA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...