HMGB3/HMG4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47434

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HMGB3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit HMGB3/HMG4 Antibody - BSA Free (NBP2-47434) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HMGB3/HMG4 Antibody - BSA Free

Western Blot: HMGB3/HMG4 Antibody [NBP2-47434]

Western Blot: HMGB3/HMG4 Antibody [NBP2-47434]

Western Blot: HMGB3/HMG4 Antibody [NBP2-47434] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: HMGB3/HMG4 Antibody [NBP2-47434]

Immunocytochemistry/ Immunofluorescence: HMGB3/HMG4 Antibody [NBP2-47434]

Immunocytochemistry/Immunofluorescence: HMGB3/HMG4 Antibody [NBP2-47434] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Analysis in human placenta and skeletal muscle tissues using NBP2-47434 antibody. Corresponding HMGB3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434]

Immunohistochemistry-Paraffin: HMGB3/HMG4 Antibody [NBP2-47434] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Applications for HMGB3/HMG4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HMGB3

HMGB3 belongs to the high mobility group (HMG) protein superfamily. Like HMG1 (MIM 163905) and HMG2 (MIM 163906), HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription (Wilke et al., 1997 [PubMed 9370291]; Nemeth et al., 2006 [PubMed 16945912]).[supplied by OMIM]

Long Name

High Mobility Group Box 3

Alternate Names

HMG2A, HMG4

Gene Symbol

HMGB3

Additional HMGB3 Products

Product Documents for HMGB3/HMG4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HMGB3/HMG4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Hematopoietic Progenitor Cell Markers

Customer Reviews for HMGB3/HMG4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HMGB3/HMG4 Antibody - BSA Free and earn rewards!

Have you used HMGB3/HMG4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies