hnRNP M Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03746

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all hnRNP M Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 491-730 of human hnRNP M (NP_005959.2). GFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRNA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for hnRNP M Antibody - BSA Free

Western Blot: hnRNP M AntibodyAzide and BSA Free [NBP3-03746]

Western Blot: hnRNP M AntibodyAzide and BSA Free [NBP3-03746]

Western Blot: hnRNP M Antibody [NBP3-03746] - Analysis of extracts of various cell lines, using hnRNP M antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunocytochemistry/Immunofluorescence: hnRNP M Antibody [NBP3-03746] - Analysis of U-2 OS cells using hnRNP M antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody [NBP3-03746] - Paraffin-embedded mouse testis using hnRNP M antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody [NBP3-03746] - Paraffin-embedded human appendix using hnRNP M antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody [NBP3-03746] - Paraffin-embedded human esophageal cancer using hnRNP M antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody - Azide and BSA Free [NBP3-03746]

Immunohistochemistry-Paraffin: hnRNP M Antibody [NBP3-03746] - Paraffin-embedded rat brain using hnRNP M antibody at dilution of 1:100 (40x lens).
hnRNP M Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody - Azide and BSA Free [hnRNP M] -

Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody - Azide and BSA Free [hnRNP M] - Immunofluorescence analysis of L929 cells using hnRNP M Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
hnRNP M Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody - Azide and BSA Free [hnRNP M] -

Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody - Azide and BSA Free [hnRNP M] - Immunofluorescence analysis of C6 cells using hnRNP M Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
hnRNP M Antibody - Azide and BSA Free

Immunohistochemistry: hnRNP M Antibody - Azide and BSA Free [hnRNP M] -

Immunohistochemistry: hnRNP M Antibody - Azide and BSA Free [hnRNP M] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using hnRNP M Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for hnRNP M Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP M

Proteins that directly bind to nascent RNA polymerase II transcripts--the heterogenous nuclear ribonucleoproteins (hnRNPs)--play an important role in both transcript-specific packaging and alternative splicing of pre-mRNAs. A group of abundant hnRNPs, the M1-M4 proteins, appear as a cluster of four proteins. The M proteins are pre-mRNA binding proteins in vivo, and they bind avidly to poly (G) and poly (U) RNA homopolymers in vitro. M proteins are members of the ribonucleoprotein consensus sequence family of RNA-binding proteins with greatest similarity to a hypothetical RNA-binding protein from Saccharomyces cerevisiae. The M proteins also possess an unusual hexapeptide-repeat region rich in methionine and arginine residues (MR repeat motif) that resembles a repeat in the 64kDa subunit of cleavage stimulation factor, which is involved in end maturation of pre-mRNAs. Proteins immunologically related to M exist in divergent eukaryotes ranging from human to yeast.

Alternate Names

DKFZp547H118, heterogeneous nuclear ribonucleoprotein M, hnRNP M, HNRNPM4, HNRPM4heterogenous nuclear ribonucleoprotein M, HNRPMheterogenous nuclear ribonucleoprotein M4, HTGR1, M4 protein, N-acetylglucosamine receptor 1, NAGR1hnRNA-binding protein M4

Gene Symbol

HNRNPM

Additional hnRNP M Products

Product Documents for hnRNP M Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for hnRNP M Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for hnRNP M Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP M Antibody - BSA Free and earn rewards!

Have you used hnRNP M Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies