HSP10/EPF Antibody (0H0X6)

Novus Biologicals | Catalog # NBP3-16604

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0H0X6 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSP10/EPF (P61604). GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HSP10/EPF Antibody (0H0X6)

Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Western blot analysis of extracts of various cell lines, using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunocytochemistry/ Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunocytochemistry/Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunofluorescence analysis of NIH-3T3 cells using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded mouse kidney using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded rat brain using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human colon using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human placenta using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
HSP10/EPF Antibody (0H0X6)

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] -

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HSP10/EPF Antibody (0H0X6)

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] -

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HSP10/EPF Antibody (0H0X6)

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] -

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HSP10/EPF Antibody (0H0X6)

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] -

Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for HSP10/EPF Antibody (0H0X6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HSP10/EPF

Hsp10 make up a family of small heat shock proteins with an approximate molecular mass of 10 kDa (Hsp10s). Also known as Cpn10, Hsp10 acts as a co-chaperone and interacts with members of the Hsp60 family (GroEL in E. coli) to promote proper folding of polypeptides. In chlamydia, Hsp10 is thought to interact with cHsp60, a reported immunopathological antigen, identifying Hsp10 as a potential contributor to an immunological response.

Long Name

Heat Shock 10 kDa Protein 1

Alternate Names

Chaperonin 10 Homolog, EPF, GroES, HSPE1

Gene Symbol

HSPE1

Additional HSP10/EPF Products

Product Documents for HSP10/EPF Antibody (0H0X6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSP10/EPF Antibody (0H0X6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for HSP10/EPF Antibody (0H0X6)

There are currently no reviews for this product. Be the first to review HSP10/EPF Antibody (0H0X6) and earn rewards!

Have you used HSP10/EPF Antibody (0H0X6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...