Hsp70 interacting protein HIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48865

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hsp70 interacting protein HIP Antibody - BSA Free

Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-48865]

Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-48865]

Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-48865] - Analysis using Anti-ST13 antibody NBP2-48865 (A) shows similar pattern to independent antibody NBP2-47427 (B).
Immunocytochemistry/ Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48865]

Immunocytochemistry/ Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48865]

Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48865] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48865]

Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48865]

Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48865] - Staining of human pancreas shows moderate cytoplasmic and nuclear positivity in islets of Langerhans.

Applications for Hsp70 interacting protein HIP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hsp70 interacting protein HIP

Hsp70 interacting protein HIP is encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene.

Alternate Names

AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein

Gene Symbol

ST13

Additional Hsp70 interacting protein HIP Products

Product Documents for Hsp70 interacting protein HIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hsp70 interacting protein HIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hsp70 interacting protein HIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hsp70 interacting protein HIP Antibody - BSA Free and earn rewards!

Have you used Hsp70 interacting protein HIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...