Human Osteocalcin Alexa Fluor® 488-conjugated Antibody Summary
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Applications
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Scientific Data
View Larger
Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488-conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
View Larger
Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488-conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Reconstitution Calculator
Preparation and Storage
- 12 months from date of receipt, 2 to 8 °C as supplied.
Background: Osteocalcin
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
Product Datasheets
Product Specific Notices
This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.
Citations for Human Osteocalcin Alexa Fluor® 488-conjugated Antibody
R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.
2
Citations: Showing 1 - 2
Filter your results:
Filter by:
-
Comparative Study of MSCA-1 and CD146 Isolated Periosteal Cell Subpopulations
Authors: F Umrath, C Thomalla, S Pöschel, K Schenke-La, S Reinert, D Alexander
Cell. Physiol. Biochem., 2018-12-12;51(3):1193-1206.
Species: Human
Sample Types: Whole Cells
Applications: Flow Cytometry -
High density lipoprotein modulates osteocalcin expression in circulating monocytes: a potential protective mechanism for cardiovascular disease in type 1 diabetes
Authors: E Maddaloni, Y Xia, K Park, S D'Eon, LJ Tinsley, R St-Louis, M Khamaisi, Q Li, GL King, HA Keenan
Cardiovasc Diabetol, 2017-09-16;16(1):116.
Species: Human
Sample Types: Whole Cells
Applications: Flow Cytometry
FAQs
No product specific FAQs exist for this product, however you may
View all Antibody FAQsReviews for Human Osteocalcin Alexa Fluor® 488-conjugated Antibody
Average Rating: 4 (Based on 1 Review)
Have you used Human Osteocalcin Alexa Fluor® 488-conjugated Antibody?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
