Osteocalcin Antibody (190125) [Alexa Fluor® 750]

R&D Systems | Catalog # IC1419S

R&D Systems

Key Product Details

Species Reactivity

Human, Rat

Applications

Intracellular Staining by Flow Cytometry

Label

Alexa Fluor 750 (Excitation = 749 nm, Emission = 775 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # 190125
Loading...

Product Specifications

Immunogen

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Specificity

Detects human Osteocalcin in direct ELISAs.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for Osteocalcin Antibody (190125) [Alexa Fluor® 750]

Application
Recommended Usage

Intracellular Staining by Flow Cytometry

0.25-1 µg/106 cells
Sample: Saos-2 human osteosarcoma cell line and human osteoblasts were fixed with paraformaldehyde and permeabilized with saponin

Spectra Viewer

Plan Your Experiments

Use our spectra viewer to interactively plan your experiments, assessing multiplexing options. View the excitation and emission spectra for our fluorescent dye range and other commonly used dyes.

Spectra Viewer

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Formulation

Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store the unopened product at 2 - 8 °C. Do not use past expiration date.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References

  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Long Name

Bone gamma-Carboxyglutamate [gla] Protein

Alternate Names

BGLAP, BGP, OCN

Entrez Gene IDs

632 (Human); 12096 (Mouse); 25295 (Rat)

Gene Symbol

BGLAP

UniProt

Additional Osteocalcin Products

Product Documents for Osteocalcin Antibody (190125) [Alexa Fluor® 750]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Note: Certificate of Analysis not available for kit components.

Product Specific Notices for Osteocalcin Antibody (190125) [Alexa Fluor® 750]


This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.

For research use only

Customer Reviews for Osteocalcin Antibody (190125) [Alexa Fluor® 750]

There are currently no reviews for this product. Be the first to review Osteocalcin Antibody (190125) [Alexa Fluor® 750] and earn rewards!

Have you used Osteocalcin Antibody (190125) [Alexa Fluor® 750]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies