Osteocalcin Antibody (190125) [Alexa Fluor® 594]
R&D Systems | Catalog # IC1419T
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Product Specifications
Immunogen
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Specificity
Clonality
Host
Isotype
Applications for Osteocalcin Antibody (190125) [Alexa Fluor® 594]
Intracellular Staining by Flow Cytometry
Sample: Saos-2 human osteosarcoma cell line and human osteoblasts were fixed with paraformaldehyde and permeabilized with saponin
Reviewed Applications
Read 1 review rated 4 using IC1419T in the following applications:
Spectra Viewer
Plan Your Experiments
Use our spectra viewer to interactively plan your experiments, assessing multiplexing options. View the excitation and emission spectra for our fluorescent dye range and other commonly used dyes.
Spectra ViewerFlow Cytometry Panel Builder
Bio-Techne Knows Flow Cytometry
Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.
Advanced Features
- Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
- Spillover Popups - Visualize the spectra of individual fluorochromes
- Antigen Density Selector - Match fluorochrome brightness with antigen density
Formulation, Preparation, and Storage
Purification
Formulation
Shipping
Stability & Storage
Background: Osteocalcin
References
- Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Long Name
Alternate Names
Gene Symbol
UniProt
Additional Osteocalcin Products
Product Documents for Osteocalcin Antibody (190125) [Alexa Fluor® 594]
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Note: Certificate of Analysis not available for kit components.
Product Specific Notices for Osteocalcin Antibody (190125) [Alexa Fluor® 594]
This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.
For research use only
Related Research Areas
Customer Reviews for Osteocalcin Antibody (190125) [Alexa Fluor® 594] (1)
Have you used Osteocalcin Antibody (190125) [Alexa Fluor® 594]?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
-
Application: Immunocytochemistry/ImmunofluorescenceSample Tested: differentiated adipose derived stem cellSpecies: HumanVerified Customer | Posted 12/05/2017
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- 7-Amino Actinomycin D (7-AAD) Cell Viability Flow Cytometry Protocol
- Extracellular Membrane Flow Cytometry Protocol
- Flow Cytometry Protocol for Cell Surface Markers
- Flow Cytometry Protocol for Staining Membrane Associated Proteins
- Flow Cytometry Staining Protocols
- Flow Cytometry Troubleshooting Guide
- Intracellular Flow Cytometry Protocol Using Alcohol (Methanol)
- Intracellular Flow Cytometry Protocol Using Detergents
- Intracellular Nuclear Staining Flow Cytometry Protocol Using Detergents
- Intracellular Staining Flow Cytometry Protocol Using Alcohol Permeabilization
- Intracellular Staining Flow Cytometry Protocol Using Detergents to Permeabilize Cells
- Propidium Iodide Cell Viability Flow Cytometry Protocol
- Protocol for Liperfluo
- Protocol for the Characterization of Human Th22 Cells
- Protocol for the Characterization of Human Th9 Cells
- Protocol: Annexin V and PI Staining by Flow Cytometry
- Protocol: Annexin V and PI Staining for Apoptosis by Flow Cytometry
- Troubleshooting Guide: Fluorokine Flow Cytometry Kits
- View all Protocols, Troubleshooting, Illustrated assays and Webinars