Human Ubiquitin/Ubiquitin+1 Antibody (83406)

R&D Systems | Catalog # MAB701

R&D Systems

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2B Clone # 83406
View all Ubiquitin/Ubiquitin+1 Primary Antibodies »

Product Specifications

Immunogen

Human Ubiquitin+1 synthetic peptide
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ

Specificity

Detects human Ubiquitin/Ubiquitin+1 in Western blots..

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2B

Scientific Data Images for Human Ubiquitin/Ubiquitin+1 Antibody (83406)

Ubiquitin/Ubiquitin+1 antibody in Human Alzheimer's Disease Brain by Immunohistochemistry (IHC-P).

Ubiquitin/Ubiquitin+1 in Human Alzheimer's Disease Brain.

Ubiquitin/Ubiquitin+1 was detected in immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex) using 25 µg/mL Mouse Anti-Human Ubiquitin/ Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter-stained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of neurons in the cortex. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Detection of Human Ubiquitin/Ubiquitin+1 antibody by Western Blot.

Detection of Human Ubiquitin/Ubiquitin+1 by Western Blot.

Western blot shows samples of Recombinant Human Ubiquitin (Catalog # 701-UB) (2, 1, and 0.5 ng) and Recombinant Human Ubiquitin+1 (Catalog # 703-UB) (2, 1, and 0.5 ng). PVDF membrane was probed with 1-2 µg/mL Mouse Anti-Human Ubiquitin/Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands for Ubiquitin and Ubiquitin+1 were detected at approximately 11 kDa and 13 kDa, respectively (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 9.

Applications for Human Ubiquitin/Ubiquitin+1 Antibody (83406)

Application
Recommended Usage

Immunohistochemistry

8-25 µg/mL
Sample: Immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex)

Western Blot

1-2 µg/mL
Sample: Recombinant Human Ubiquitin (Catalog # 701-UB)

Reviewed Applications

Read 1 review rated 4 using MAB701 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Reconstitution

Reconstitute at 0.5 mg/mL in sterile PBS. For liquid material, refer to CoA for concentration.

Formulation

Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.

Shipping

Lyophilized product is shipped at ambient temperature. Liquid small pack size (-SP) is shipped with polar packs. Upon receipt, store immediately at the temperature recommended below.

Stability & Storage

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.

Calculators

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Background: Ubiquitin/Ubiquitin+1

Ubiquitin+1 has a carboxyl terminal amino acid sequence that differs from normal Ubiquitin. The different carboxyl terminal sequence appears to result from a frameshift in the Ubiquitin mRNA. The underlying mechanisms creating the mRNA frameshift are not clearly understood. The occurrence of the frameshift that generates Ubiquitin+1 is much more prevalent in patients with Alzheimers Disease or with Down Syndrome than in control individuals who are not afflicted with the disorders. The monoclonal anti-Ubiquitin+1 (Catalog # MAB703) and rabbit polyclonal anti-Ubiquitin+1 (Catalog # AF703) antibodies were raised against the Ubiquitin+1 carboxyl terminal sequence that differs from normal Ubiquitin and are therefore non-reactive with Ubiquitin. Monoclonal anti-Ubiquitin (Catalog # MAB701) detects both Ubiquitin and Ubiquitin+1 indicating that the epitope recognized by this antibody is contained in the portion of the proteins that are identical.

Long Name

frame shift mutant

Alternate Names

HEL-S-50, UBB

Entrez Gene IDs

7314 (Human); 298693 (Rat)

Gene Symbol

UBB

Additional Ubiquitin/Ubiquitin+1 Products

Product Documents for Human Ubiquitin/Ubiquitin+1 Antibody (83406)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Note: Certificate of Analysis not available for kit components.

Download SDS

Product Specific Notices for Human Ubiquitin/Ubiquitin+1 Antibody (83406)

For research use only

Related Research Areas

NFkB Pathway

Citations for Human Ubiquitin/Ubiquitin+1 Antibody (83406)

Customer Reviews for Human Ubiquitin/Ubiquitin+1 Antibody (83406) (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Human Ubiquitin/Ubiquitin+1 Antibody (83406)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card
Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: See PMID 21505015
    Species: Human
    Verified Customer | Posted 02/25/2015

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies