IFI16 Antibody (2E3) - Azide and BSA Free
Novus Biologicals | Catalog # H00003428-M03
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 2E3
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Localization
Nuclear
Specificity
IFI16 - interferon, gamma-inducible protein 16
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for IFI16 Antibody (2E3) - Azide and BSA Free
Western Blot: IFI16 Antibody (2E3) [H00003428-M03]
Western Blot: IFI16 Antibody (2E3) [H00003428-M03] - Analysis of IFI16 expression in transfected 293T cell line by IFI16 monoclonal antibody (M03), clone 2E3. Lane 1: IFI16 transfected lysatE (82 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: IFI16 Antibody (2E3) [H00003428-M03]
Immunocytochemistry/Immunofluorescence: IFI16 Antibody (2E3) [H00003428-M03] - Analysis of monoclonal antibody to IFI16 on HeLa cell. Antibody concentration 10 ug/mlImmunohistochemistry-Paraffin: IFI16 Antibody (2E3) [H00003428-M03]
Immunohistochemistry-Paraffin: IFI16 Antibody (2E3) [H00003428-M03] - Analysis of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/mlWestern Blot: IFI16 Antibody (2E3) [H00003428-M03]
Western Blot: IFI16 Antibody (2E3) [H00003428-M03] - Western Blot analysis of IFI16 expression in Hela NE ( Cat # L013V3 ).Western Blot: IFI16 Antibody (2E3) [H00003428-M03]
Western Blot: IFI16 Antibody (2E3) [H00003428-M03] - Analysis of IFI16 expression in Jurkat.ELISA: IFI16 Antibody (2E3) [H00003428-M03]
ELISA: IFI16 Antibody (2E3) [H00003428-M03] - Detection limit for recombinant GST tagged IFI16 is approximately 0.3ng/ml as a capture antibody.Western Blot: IFI16 Antibody (2E3) - Azide and BSA Free [H00003428-M03] -
STING pathway analysis. (A) STING mRNA relative expression in uninfected (CTR), HHV-6A, HHV-6B or HHV-7 infected NK92 cells 3d.p.i. ∗p values Student t test; (B) Western Blot analysis for house-keeping actin (upper blot) and STING (lower blot) expression in uninfected (CTR), HHV-6A, HHV-6B or HHV-7 infected NK92 cells 3d.p.i. For stimulation of the cytoplasmic DNA sensing pathways, we used 2′,3′-cGAMP. The molecular weights were determined by protein ladder (14.4-97.4kDa) (BioRad). Actin was evidenced at 44kDa, STING 35kDa. The images were acquired by Geliance 600 (Perkin Elmer, MA, United States). The complete Western Blots are reported in Supplementary Figure S3. ∗p value Student t test. The histogram represents the STING band intensity in relation with the corresponding actin band. (C) Western Blot analysis for house-keeping actin (upper blot) and cGas, IFI16, TBK1, IRF3, pIRF3Ser396, STAT6, pSTAT6Tyr641 (lower blots) expression in uninfected (CTR), HHV-6A, HHV-6B or HHV-7 infected NK92 cells 3 d.p.i. The molecular weights were determined by protein ladder (25-250kDa; 14.4-97.4 kDa). Actin was evidenced at 44kDa, cGas at 68kDa, IFI16 at 100kDa, TBK1 at 80kDa, IRF3 at 55kDa, STAT6 at 120kDa. The histogram represents the STING band intensity in relation with the corresponding actin band. ∗p value Student t test. The images were acquired by Geliance 600 (Perkin Elmer, MA, United States). The complete Western Blots are reported in Supplementary Figure S3. (D) HHV-6A infected NK92 cells were characterized by immunofluorescence for STING [anti-STING PE Ab (Clone T3-680)], STAT6 [anti-STAT6 FITC (Clone D-1)] and gp116 (Clone 6A5) expression. (Nikon Eclipse TE2000S) equipped with a digital camera. Original magnification 100×. Uninfected NK92 cells were used as control. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32140147), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for IFI16 Antibody (2E3) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: IFI16
Alternate Names
Ifi-16, IFNGIP1gamma-interferon-inducible protein 16, interferon, gamma-inducible protein 16, interferon-gamma induced protein IFI 16, Interferon-inducible myeloid differentiation transcriptional activator, MGC9466, PYHIN2
Entrez Gene IDs
3428 (Human)
Gene Symbol
IFI16
OMIM
147586 (Human)
UniProt
Additional IFI16 Products
Product Documents for IFI16 Antibody (2E3) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for IFI16 Antibody (2E3) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for IFI16 Antibody (2E3) - Azide and BSA Free
Customer Reviews for IFI16 Antibody (2E3) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review IFI16 Antibody (2E3) - Azide and BSA Free and earn rewards!
Have you used IFI16 Antibody (2E3) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...