IGFBP-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33475

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IGFBP-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit IGFBP-1 Antibody - BSA Free (NBP2-33475) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-IGFBP-1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for IGFBP-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining in human placenta and skeletal muscle tissues using NBP2-33475 antibody. Corresponding IGFBP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human kidney, lymphoid tissues, placenta and skeletal muscle using Anti-IGFBP1 antibody NBP2-33475 (A) shows similar protein distribution across tissues to independent antibody NBP2-33599 (B).
Immunocytochemistry/ Immunofluorescence: IGFBP-1 Antibody [NBP2-33475]

Immunocytochemistry/ Immunofluorescence: IGFBP-1 Antibody [NBP2-33475]

Immunocytochemistry/Immunofluorescence: IGFBP-1 Antibody [NBP2-33475] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human placenta shows moderate cytoplasmic positivity in decidual cells.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475]

Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Applications for IGFBP-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGFBP-1

IGFBP1 is a gene that codes for an IGF-binding protein that circulates in the plasma and prolongs the half-life of IGFs and works to either inhibit of stimulate the growth promoting effects while also promoting cell migration and has a length of 259 amino acids and a weight of approximately 28 kDa. Current studies are being done on several diseases and disorders relating to this gene including protein-energy malnutrition, pre-eclampsia, persistent fetal circulation syndrome, Silver-Russell syndrome, growth hormone deficiency, Ehlers-Danlos syndrome, glucose intolerance, Prader-Willi syndrome, and chronic fatigue syndrome. IGFBP1 has also been shown to have interactions with IGF1, IGF2, MMP26, TF, and ARNT in pathways such as the myometrial relaxation and contraction, HIF-1-alpha transcription factor, IGF regulation, and protein metabolism pathways.

Long Name

Insulin-like Growth Factor Binding Protein 1

Alternate Names

IGFBP1

Gene Symbol

IGFBP1

UniProt

P08833

Additional IGFBP-1 Products

Product Documents for IGFBP-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IGFBP-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IGFBP-1 Antibody - BSA Free

Customer Reviews for IGFBP-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IGFBP-1 Antibody - BSA Free and earn rewards!

Have you used IGFBP-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies