Involucrin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33742

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Involucrin Antibody - BSA Free

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining in human esophagus and stomach tissues. Corresponding IVL RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Involucrin Antibody [NBP2-33742]

Immunocytochemistry/ Immunofluorescence: Involucrin Antibody [NBP2-33742]

Immunocytochemistry/Immunofluorescence: Involucrin Antibody [NBP2-33742] - Staining of human cell line HaCaT shows localization to nuclear bodies, cytosol & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: citrate. Antibody dilution: 1:100. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human esophagus shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human stomach shows no cytoplasmic positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Simple Western: Involucrin Antibody [NBP2-33742]

Simple Western: Involucrin Antibody [NBP2-33742]

Simple Western: Involucrin Antibody [NBP2-33742] - Analysis in human HaCaT cells. 200 ug/mL protein concentration and 1/50 antibody dilution. Simmple Western image submitted by a verified customer review.

Applications for Involucrin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in Human HaCaT cells, separated by Size, antibody dilution of 1:50

Reviewed Applications

Read 2 reviews rated 3.5 using NBP2-33742 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Involucrin

Stains paraffin embedded human tissue, so will be useful for studies of changes in involucrin expression in pathological studies.

Alternate Names

involucrin

Gene Symbol

IVL

UniProt

Additional Involucrin Products

Product Documents for Involucrin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Involucrin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Involucrin Antibody - BSA Free (2)

3.5 out of 5
2 Customer Ratings
5 Stars
0%
4 Stars
50%
3 Stars
50%
2 Stars
0%
1 Stars
0%

Have you used Involucrin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 22 reviews Showing All
Filter By:
  • Involucrin Antibody
    Name: Agnès Tessier
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Skin tissue
    Species: Human
    Verified Customer | Posted 02/27/2020
    Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: citrate. Antibody dilution: 1:100
    Involucrin Antibody - BSA Free NBP2-33742
  • Involucrin Antibody
    Name: Agnès Tessier
    Application: Simple Western
    Sample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
    Species: Human
    Verified Customer | Posted 06/17/2019
    Detection of involucrin by Simple Western (JESS) in reconstructed human epidermis lysate (about 200 µg/mL protein concentration). Antibody dilution: 1/50
    Involucrin Antibody - BSA Free NBP2-33742
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 22 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...