Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Involucrin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Involucrin Antibody [NBP2-33742]
Immunocytochemistry/Immunofluorescence: Involucrin Antibody [NBP2-33742] - Staining of human cell line HaCaT shows localization to nuclear bodies, cytosol & centrosome. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: citrate. Antibody dilution: 1:100. IHC-P image submitted by a verified customer review.Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human esophagus shows moderate to strong cytoplasmic positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human stomach shows no cytoplasmic positivity in glandular cells as expected.Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742]
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in squamous epithelial cells.Simple Western: Involucrin Antibody [NBP2-33742]
Simple Western: Involucrin Antibody [NBP2-33742] - Analysis in human HaCaT cells. 200 ug/mL protein concentration and 1/50 antibody dilution. Simmple Western image submitted by a verified customer review.Applications for Involucrin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25 - 2 ug/mL
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Simple Western
1:50
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in Human HaCaT cells, separated by Size, antibody dilution of 1:50
Reviewed Applications
Read 2 reviews rated 3.5 using NBP2-33742 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Involucrin
Additional Involucrin Products
Product Documents for Involucrin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Involucrin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Involucrin Antibody - BSA Free (2)
3.5 out of 5
2 Customer Ratings
Have you used Involucrin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 的
2 reviews
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Skin tissueSpecies: HumanVerified Customer | Posted 02/27/2020Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: citrate. Antibody dilution: 1:100
-
Application: Simple WesternSample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cellsSpecies: HumanVerified Customer | Posted 06/17/2019Detection of involucrin by Simple Western (JESS) in reconstructed human epidermis lysate (about 200 µg/mL protein concentration). Antibody dilution: 1/50Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...