Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87428

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human kidney shows moderate positivity in cells in tubules.
Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining in human prostate and skeletal muscle tissues.. Corresponding IDH1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human prostate shows strong positivity in glandular cells.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.

Applications for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Isocitrate Dehydrogenase 1/IDH1

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq]

Alternate Names

IDCD, IDH1, IDP, IDPC, PICD

Gene Symbol

IDH1

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Product Documents for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Customer Reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free and earn rewards!

Have you used Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...