KBTBD10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80788

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KBTBD10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KBTBD10 Antibody - BSA Free

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human lymph node.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining in human skeletal muscle and liver tissues using anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody NBP1-80788 (A) shows similar protein distribution across tissues to independent antibody NBP1-80787 (B).
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788]

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80788] - Staining of human colon.
KBTBD10 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: KBTBD10 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: KBTBD10 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-KBTBD10 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for KBTBD10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KBTBD10

KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins

Alternate Names

FLJ60989, kelch repeat and BTB (POZ) domain containing 10, kelch repeat and BTB domain-containing protein 10, Kelch-related protein 1, Kel-like protein 23, KRP1, Sarcosin, SARCOSINsarcomeric muscle protein

Entrez Gene IDs

10324 (Human)

Gene Symbol

KBTBD10

Additional KBTBD10 Products

Product Documents for KBTBD10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KBTBD10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KBTBD10 Antibody - BSA Free

Customer Reviews for KBTBD10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KBTBD10 Antibody - BSA Free and earn rewards!

Have you used KBTBD10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies