KIF21A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37969

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KIF21A Antibody - BSA Free

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding KIF21A RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: KIF21A Antibody [NBP2-37969]

Immunocytochemistry/ Immunofluorescence: KIF21A Antibody [NBP2-37969]

Immunocytochemistry/Immunofluorescence: KIF21A Antibody [NBP2-37969] - Staining of human cell line SH-SY5Y shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human fallopian tube shows strong cytoplasmic and moderate luminal membranous positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969]

Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human skeletal muscle shows weak positivity in myocytes.

Applications for KIF21A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIF21A

KIF21A belongs to a family of plus end-directed kinesin (see MIM 600025) motor proteins. Neurons use kinesin and dynein (see MIM 600112) microtubule-dependent motor proteins to transport essential cellular components along axonal and dendritic microtubules.(supplied by OMIM)

Alternate Names

CFEOM1, CFEOM3B, FEOM1, FEOM3A, fibrosis of the extraocular muscles, congenital, 1, FLJ20052, KIAA1708DKFZp779C159, KIF2, kinesin family member 21A, Kinesin-like protein KIF2, kinesin-like protein KIF21A, Renal carcinoma antigen NY-REN-62

Gene Symbol

KIF21A

UniProt

Additional KIF21A Products

Product Documents for KIF21A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KIF21A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIF21A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIF21A Antibody - BSA Free and earn rewards!

Have you used KIF21A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...