KIF22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82876

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KIF22 Antibody - BSA Free

Western Blot: KIF22 Antibody [NBP1-82876]

Western Blot: KIF22 Antibody [NBP1-82876]

Western Blot: KIF22 Antibody [NBP1-82876] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
KIF22 Antibody - BSA Free Immunohistochemistry-Paraffin: KIF22 Antibody [NBP1-82876]

Immunohistochemistry-Paraffin: KIF22 Antibody [NBP1-82876]

Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Applications for KIF22 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIF22

KIF22 is encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Alternate Names

Kid, KIDA-328A3.2, kinesin family member 22, kinesin-like 4, Kinesin-like DNA-binding protein, Kinesin-like protein 4, kinesin-like protein KIF22, KNSL4kinesin-like DNA-binding protein pseudogene, OBP, OBP-1, OBP-2, origin of plasmid DNA replication-binding protein, oriP binding protein

Gene Symbol

KIF22

Additional KIF22 Products

Product Documents for KIF22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KIF22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KIF22 Antibody - BSA Free

Customer Reviews for KIF22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIF22 Antibody - BSA Free and earn rewards!

Have you used KIF22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF22 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All
  • Q: Our lab is planning to purchase the product KIF22 Antibody (NBP1-82876) from your company and I'm wondering if the protocol you provide online (ICC protocol) is what you used for that antibody? Is there any specific attention we should pay in order to use this protocol for immunofluorescence with KIF22 Antibody (NBP1-82876)? Thanks a lot!

    A:

    Our lab did not use any customized protocol for the validation of this antibody and the only special recommendation would be about fixation using PFA and permeabilization by Triton X-100. This antibody should work for ICC-IF at a working concentration of 1-4 ug/ml. Please see our commonly used ICC-IF protocol. Novus Biologicals stand by the quality of its products and all of our products are 100% guaranteed. We are always there to help in case you face any trouble in generating your desired outcome out of the use of our products.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies
Loading...