KLF8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57740

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KLF8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31827393).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KLF8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740]

Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740]

Immunocytochemistry/Immunofluorescence: KLF8 Antibody [NBP2-57740] - Staining of human cell line RT4 shows localization to nucleoplasm & aggresome.
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740]

Immunocytochemistry/ Immunofluorescence: KLF8 Antibody [NBP2-57740]

KLF8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57740-img0002.jpg
KLF8 Antibody

Western Blot: KLF8 Antibody [NBP2-57740] -

Western Blot: KLF8 Antibody [NBP2-57740] - MiR-135a-5p overexpression suppressed tumor cell progression & KLF8 expression in vitro. a Relative expression of miR-135a-5p in different TSCC cell lines was examined using qRT-PCR. b Relative expression of miR-135a-5p was measured in CAL-27 & TCa-8113 cells transfected with miR-135a-5p mimics by qRT-PCR. c The viability of CAL-27 & TCa-8113 cells was measured using MTT assay. d, e The migration & invasion of CAL-27 & TCa-8113 cells was examined using wound healing assay & transwell assay, respectively. f Relative expression of KLF8 mRNA was detected in CAL-27 & TCa-8113 cells using qRT-PCR. g Relative expression of KLF8 protein was measured using western blot in CAL-27 & TCa-8113 cells. *p < 0.05, **p  < 0.01, ***p < 0.001, versus to NC mimics Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
KLF8 Antibody

Western Blot: KLF8 Antibody [NBP2-57740] -

Western Blot: KLF8 Antibody [NBP2-57740] - DANCR knockdown repressed tumor cell progression & KLF8 expression by targeting miR-135a-5p in vitro. a The viability of CAL-27 & TCa-8113 cells was measured using MTT assay. b, c The migration & invasion of CAL-27 & TCa-8113 cells were detected by wound healing assay & transwell assay, respectively. d Relative expression of MMP-2 & MMP-9 protein was determined by western blot in CAL-27 & TCa-8113 cells. e Relative expression of KLF8 protein was detected using western blot in CAL-27 & TCa-8113 cells. *p < 0.05, **p < 0.01, ***p < 0.001, versus to si-NC; &p < 0.05, &&p < 0.01, &&&p < 0.001, versus to si-DANCR-1 + NC inhibitor Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
KLF8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KLF8 Antibody - BSA Free [NBP2-57740] -

DANCR knockdown blocked the tumor formation in vivo involving KLF8 activation. CAL-27 or TCa-8113 cells transfected with shRNA against DANCR were inoculated subcutaneously into the nude mice. Xenografts were measured every 4 days with a caliper. a Tumor volumes were measured every 4 days. b Mice were sacrificed after 25 days, and xenograft tumors were excised and weighed. c Relative expression of MMP-2 and MMP-9 protein in tumor tissues was measured by western blot after 25 days. d Relative expression of KLF8 protein in tumor tissues was examined by western blot after 25 days. e Immunofluorescence staining was performed to investigate KLF8 immunoreactive materials in tumor tissues after 25 days. ***p < 0.001, versus to sh-NC Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
KLF8 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: KLF8 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: KLF8 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-KLF8 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for KLF8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

Use in IHC-P reported in scientific literature (PMID:31827393).

Western Blot

Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31827393), licensed under a CC-BY licence.
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KLF8

The KLF8 gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in t

Alternate Names

Basic krueppel-like factor 3, basic kruppel-like factor 3, BKLF3DKFZp686O08126, DXS741, Krueppel-like factor 8, Kruppel-like factor 8, Zinc finger protein 741, ZNF741MGC138314

Gene Symbol

KLF8

Additional KLF8 Products

Product Documents for KLF8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KLF8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KLF8 Antibody - BSA Free

Customer Reviews for KLF8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KLF8 Antibody - BSA Free and earn rewards!

Have you used KLF8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies