Ku70/XRCC6 Antibody (8L6B6)
Novus Biologicals | Catalog # NBP3-15358
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 8L6B6 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70/XRCC6 (P12956). PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Ku70/XRCC6 Antibody (8L6B6)
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358]
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Ku70/XRCC6 Rabbit mAb (NBP3-15358) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Western Blot: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -
Western Blot: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] - Analysis of lysates from A-549 cells using Ku70 Rabbit mAb at 1:6000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.Immunocytochemistry/Immunofluorescence: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -
Immunocytochemistry/Immunofluorescence: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -Confocal imaging of U-2 OS cells using Ku70 Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -Analysis of paraffin-embedded Human tonsil tissue using Ku70 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody (8L6B6) [NBP3-15358] -Analysis of paraffin-embedded Human esophagus tissue using Ku70 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] -
Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Ku70/XRCC6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] -
Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Ku70/XRCC6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] -
Immunocytochemistry/ Immunofluorescence: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Confocal imaging of U-2 OS cells using Ku70/XRCC6 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] -
Immunohistochemistry: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Ku70/XRCC6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Western Blot: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] -
Western Blot: Ku70/XRCC6 Antibody (8L6B6) [Ku70/XRCC6] - Western blot analysis of lysates from A-549 cells using Ku70/XRCC6 Rabbit mAb at 1:6000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Applications for Ku70/XRCC6 Antibody (8L6B6)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:100 - 1:1000
Immunohistochemistry
1:200 - 1:800
Immunohistochemistry-Paraffin
1:200 - 1:800
Western Blot
1:6000 - 1:36000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Ku70/XRCC6
Long Name
Lupus Ku Autoantigen Protein 70
Alternate Names
CTC75, CTCBF, G22P1, ML8, TLAA, XRCC6
Gene Symbol
XRCC6
Additional Ku70/XRCC6 Products
Product Documents for Ku70/XRCC6 Antibody (8L6B6)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Ku70/XRCC6 Antibody (8L6B6)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Ku70/XRCC6 Antibody (8L6B6)
There are currently no reviews for this product. Be the first to review Ku70/XRCC6 Antibody (8L6B6) and earn rewards!
Have you used Ku70/XRCC6 Antibody (8L6B6)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...