L3HYPDH Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31648

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPRGHRDMYGAVLVPSEL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for L3HYPDH Antibody - BSA Free

Western Blot: L3HYPDH Antibody [NBP2-31648]

Western Blot: L3HYPDH Antibody [NBP2-31648]

Western Blot: L3HYPDH Antibody [NBP2-31648] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-87 MG
Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648]

Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648]

Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648] - L3HYPDH at 1:25, using EDTA pre-treatment, on WHO grade I and II meningioma cell lysates on paraffin slides. Relatively weak staining requiring a very high antibody concentration to obtain good quality tissue stains. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648]

Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648]

Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for L3HYPDH Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. L3HYPDH antibody validated for IHC-P from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP2-31648 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: L3HYPDH

C14orf149 catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNAto NAD to produce ADP-ribose 1''-2'' cyclic phosphate (Probable)

Alternate Names

C14orf149, chromosome 14 open reading frame 149, EC 5.1.1.4, FLJ25436, probable proline racemase, proline racemase-like

Gene Symbol

L3HYPDH

UniProt

Additional L3HYPDH Products

Product Documents for L3HYPDH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for L3HYPDH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for L3HYPDH Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used L3HYPDH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • L3HYPDH Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: IHC-P Sample Tested, whole cell lysate, Sample Amount: 40 ug and Tissue Lysates
    Species: Human
    Verified Customer | Posted 04/11/2019
    L3HYPDH at 1:25, using EDTA pre-treatment, on WHO grade I and II meningioma paraffin slides. Relatively weak staining requiring a very high antibody concentration to obtain good quality tissue stains.
    L3HYPDH Antibody - BSA Free NBP2-31648

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...