Lactalbumin Alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87715

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lactalbumin Alpha Antibody - BSA Free

Western Blot: Lactalbumin Alpha Antibody [NBP1-87715]

Western Blot: Lactalbumin Alpha Antibody [NBP1-87715]

Western Blot: Lactalbumin Alpha Antibody [NBP1-87715] - Analysis in control (vector only transfected HEK293T lysate) and lALBA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Lactalbumin Alpha Antibody [NBP1-87715]

Immunohistochemistry-Paraffin: Lactalbumin Alpha Antibody [NBP1-87715]

Immunohistochemistry-Paraffin: Lactalbumin Alpha Antibody [NBP1-87715] - Staining of human lactating breast shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Lactalbumin Alpha Antibody [NBP1-87715] -

Immunohistochemistry-Paraffin: Lactalbumin Alpha Antibody [NBP1-87715] - staining of human cerebral cortex, colon, lactating breast and testis using Anti-LALBA antibody NBP1-87715 (A) shows similar protein distribution across tissues to independent antibody.
Lactalbumin Alpha Antibody Lactalbumin Alpha Antibody

Immunohistochemistry-Paraffin:Lactalbumin Alpha Antibody [NBP1-87715] -

Immunohistochemistry-Paraffin-Lactalbumin Alpha Antibody [NBP1-87715] - Lactalbumin Alpha Antibody [NBP1-87715] -Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Lactalbumin Alpha Antibody Lactalbumin Alpha Antibody

Lactalbumin Alpha Antibody [NBP1-87715] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Lactalbumin Alpha Antibody [NBP1-87715] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Applications for Lactalbumin Alpha Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lactalbumin Alpha

Alpha-LA is the B protein of lactose synthetase secreted by the mammary epithelial cells. a-LA is a potent Ca(2+)-elevating and apoptosis-inducing agent with broad, yet selective, cytotoxic activity. Multimeric a-LA kills all transformed, embryonic, and lymphoid cells tested but spared mature epithelial elements. It suggests that milk contributes to mucosal immunity not only by furnishing antimicrobial molecules but also by policing the function of lymphocytes and epithelium. a-LA may be helpful in ascertaining the site of origin of metastatic breast tumors

Alternate Names

alpha-lactalbumin, lactalbumin, alpha-, Lactose synthase B protein, Lysozyme-like protein 7, LYZL7, MGC138521, MGC138523

Gene Symbol

LALBA

Additional Lactalbumin Alpha Products

Product Documents for Lactalbumin Alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lactalbumin Alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lactalbumin Alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lactalbumin Alpha Antibody - BSA Free and earn rewards!

Have you used Lactalbumin Alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...