LAT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81324

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LAT Antibody - BSA Free

Western Blot: LAT Antibody [NBP1-81324]

Western Blot: LAT Antibody [NBP1-81324]

Western Blot: LAT Antibody [NBP1-81324] - Staining of human tonsil shows high expression.
Immunocytochemistry/ Immunofluorescence: LAT Antibody [NBP1-81324]

Immunocytochemistry/ Immunofluorescence: LAT Antibody [NBP1-81324]

Immunocytochemistry/Immunofluorescence: LAT Antibody [NBP1-81324] - Staining of human cell line HEL shows localization to plasma membrane & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LAT Antibody [NBP1-81324]

Immunohistochemistry-Paraffin: LAT Antibody [NBP1-81324]

Immunohistochemistry-Paraffin: LAT Antibody [NBP1-81324] - Staining in human tonsil and cerebral cortex tissues using anti-LAT antibody. Corresponding LAT RNA-seq data are presented for the same tissues.
Western Blot: LAT Antibody [NBP1-81324]

Western Blot: LAT Antibody [NBP1-81324]

Western Blot: LAT Antibody [NBP1-81324] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: LAT Antibody [NBP1-81324]

Immunohistochemistry-Paraffin: LAT Antibody [NBP1-81324]

Immunohistochemistry-Paraffin: LAT Antibody [NBP1-81324] - Staining of human cerebral cortex shows low expression as expected.

Applications for LAT Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LAT

LAT (linker for activation of T-cells) is involved in the T-cell antigen receptor (TCR) signal transduction pathway, and may play an important role downstream in activating protein tyrosine kinases (1). LAT is phosphorylated by ZAP-70/Syk protein tyrosine kinases leading to recruitment of multiple signaling molecules (2). It has been found that Tyr191 and Tyr171 are required for T-cell activation and Tyr132 is required for the activation of PLCgamma1 and Ras signaling pathways, respectively. Tyr226 and Tyr191 are required for Vav binding, whereas Tyr171 and Tyr132 are necessary for association and activation of phosphoinositide 3-kinase activity and PLCgamma1 (3).

Long Name

Linker for Activation of T cells

Alternate Names

pp36

Gene Symbol

LAT

Additional LAT Products

Product Documents for LAT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LAT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LAT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LAT Antibody - BSA Free and earn rewards!

Have you used LAT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...