LDB3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14190

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LDB3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LDB3 Antibody - BSA Free

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190]

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190]

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry: LDB3 Antibody [NBP2-14190]

Immunohistochemistry: LDB3 Antibody [NBP2-14190]

Immunohistochemistry: LDB3 Antibody [NBP2-14190] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190]

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190]

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190]

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190]

Immunohistochemistry-Paraffin: LDB3 Antibody [NBP2-14190] - Staining in human skeletal muscle and prostate tissues using anti-LDB3 antibody. Corresponding LDB3 RNA-seq data are presented for the same tissues.

Applications for LDB3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LDB3

LDB3 encodes a PDZ domain-containing protein. PDZ motifs are modular protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins interact with each other in cytoskeletal assembly or with other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM domains. The LIM domain is a cysteine-rich motif defined by 50-60 amino acids containing two zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this gene have been associated with myofibrillar myopathy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been identified; all isoforms have N-terminal PDZ domains while only longer isoforms (1 and 2) have C-terminal LIM domains. [provided by RefSeq]

Alternate Names

CMD1C, CYPHER, KIAA01613, KIAA0613FLJ35865, LDB3Z1, LDB3Z4, LIM domain binding 3, LIM domain-binding protein 3, ORACLE, PDLIM6, PDZ and LIM domain 6, Protein cypher, ZASPLVNC3, Z-band alternatively spliced PDZ-motif protein

Gene Symbol

LDB3

Additional LDB3 Products

Product Documents for LDB3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LDB3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LDB3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LDB3 Antibody - BSA Free and earn rewards!

Have you used LDB3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies