LMO7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83915

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LMO7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%). Porcine reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LMO7 Antibody - BSA Free

Western Blot: LMO7 Antibody [NBP1-83915]

Western Blot: LMO7 Antibody [NBP1-83915]

Western Blot: LMO7 Antibody [NBP1-83915] - Analysis in human cell lines HeLa and HEK293 using anti-LMO7 antibody. Corresponding LMO7 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: LMO7 Antibody [NBP1-83915]

Immunocytochemistry/ Immunofluorescence: LMO7 Antibody [NBP1-83915]

Immunocytochemistry/Immunofluorescence: LMO7 Antibody [NBP1-83915] - Staining of human cell line A-431 shows localization to cytosol & actin filaments. Antibody staining is shown in green.
Immunohistochemistry: LMO7 Antibody [NBP1-83915]

Immunohistochemistry: LMO7 Antibody [NBP1-83915]

Immunohistochemistry: LMO7 Antibody [NBP1-83915] - LMO7 staining in Porcine Cardiac Tissue: No Primary Control, Isotype IgG Control, LMO7 1:500 dilution (Image 1 and 2). IHC images submitted by a verified customer review.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human uterine cervix shows moderate nuclear and membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human duodenum shows both membranous and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human skeletal muscle shows moderate nuclear and cytoplasmic positivity in striated muscle fibers.
Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915]

Immunohistochemistry-Paraffin: LMO7 Antibody [NBP1-83915] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
LMO7 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LMO7 Antibody - BSA Free [NBP1-83915] -

p130Cas associates with Lmo7 in HeLa cells and MEFs.(A) HeLa cells that transiently expressed Myc-tagged p130Cas were immunoprecipitated with Myc antibodies and immunoblotted for endogenous Lmo7. (B, C) HeLa cells or MEFs were plated on fibronectin-coated coverslips two hours, fixed and double-stained by indirect immunofluorescence for endogenous Lmo7 (green) and endogenous p130Cas (red), then imaged by epifluorescence (B) or TIRF microscopy (C). Scale bars, 10 um. Insets show each white-boxed region at higher magnification. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/24010014), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for LMO7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-83915 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMO7

LMO7 contains a calponin homology (CH) domain, a PDZ domain, and a LIM domain. An F-box (FBX) domain is present in alternative splice variants. Members of the LIM protein family carry the LIM domain, a unique cysteine-rich zinc-binding domain. Members of the FBX protein family are involved in protein-protein interactions. The encoded protein may be involved in protein-protein interactions. Multiple alternative splice variants have been described but their full-length sequences have not been determined.

Alternate Names

FBX20F-box only protein 20, KIAA0858FBXO20F-box protein Fbx20, LIM domain 7, LIM domain only 7, LIM domain only protein 7, LMO-7, LOMP, zinc-finger domain-containing protein

Gene Symbol

LMO7

Additional LMO7 Products

Product Documents for LMO7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LMO7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LMO7 Antibody - BSA Free

Customer Reviews for LMO7 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used LMO7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • LMO7 Antibody
    Name: Anonymous
    Application: Immunohistochemistry
    Sample Tested: cardiac tissue
    Species: Other and Porcine
    Verified Customer | Posted 10/08/2021
    LMO7 staining in Porcine Cardiac Tissue: No Primary Control, Isotype IgG Control, LMO7 1:500 dil (Image 1 and 2)
    Staining was optimized in porcine cardiac tissue. Dewax, Reydrate and Antigen Retrieval= 1X Trilogy solution (Cell Marque) Peroxidase Block = 3% H202 Primary Concentration = 1:500 Wash Buffer = 1X TBS -0.1%Tween Block Buffer = Dako Serum Free Protein Block Detection= EnVision Detection Systems Peroxidase/DAB, HRP.
    LMO7 Antibody - BSA Free NBP1-83915
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies