Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to GAA(glucosidase, alpha; acid ) The peptide sequence was selected from the N terminal of GAA. Peptide sequence FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for LYAG/GAA Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: LYAG/GAA Antibody [NBP1-69295]
Immunocytochemistry/Immunofluorescence: LYAG/GAA Antibody [NBP1-69295] - LYAG was probed in human fibroblasts fixed with 4% PFA. Cells were permeabilized and blocked in 0.1% Tween and 1% Bovine serum albumin. Anti-LYAG was incubated overnight at 4C in PBS with 0.1% Tween and 1% Bovine serum albumin. Secondary antibody was anti-rabbit conjugated to Alexa Fluor 568. LYAG is shown in green and the nucleus in blue (Hoescht stain). Image is courtesy of customer review.Western Blot: LYAG/GAA Antibody [NBP1-69295]
Western Blot: LYAG/GAA Antibody [NBP1-69295] - This Anti-GAA antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.Immunohistochemistry: Rabbit Polyclonal LYAG/GAA Antibody [NBP1-69295] -
Rabbit Anti-LYAG/GAA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasmic in alveolar type I cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Applications for LYAG/GAA Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:10-1:500
Immunohistochemistry
1:10-1:500
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 3 using NBP1-69295 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Lysosomal alpha-Glucosidase
Long Name
Glucosidase, Alpha; Acid
Alternate Names
Acid alpha-Glucosidase, Acid Maltase, GAA, LYAG, Lysosomal alphaGlucosidase
Entrez Gene IDs
2548 (Human)
Gene Symbol
GAA
UniProt
Additional Lysosomal alpha-Glucosidase Products
Product Documents for LYAG/GAA Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LYAG/GAA Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for LYAG/GAA Antibody - BSA Free (1)
3 out of 5
1 Customer Rating
Have you used LYAG/GAA Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: Human fibroblastSpecies: HumanVerified Customer | Posted 04/05/2017LYAG was probed in human fibroblasts fixed with 4% PFA. Cells were permeabilized and blocked in 0.1% Tween and 1% Bovine serum albumin. Anti-LYAG was incubated overnight at 4C in PBS with 0.1% Tween and 1% Bovine serum albumin. Secondary antibody was anti-rabbit conjugated to Alexa Fluor 568. LYAG is shown in green and the nucleus in blue (Hoescht stain). Overall, the anitibody gave good signal, but with a significantly high cell-specific background as evident by some nuclear stain.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...