LYPLA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92089

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LYPLA3 Antibody - BSA Free

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human colon, kidney, lymph node and placenta using Anti-PLA2G15 antibody NBP1-92089 (A) shows similar protein distribution across tissues to independent antibody NBP1-92088 (B).
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human colon strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089]

Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human lymph node shows weak to moderate cytoplasmic positivity in non-germinal center cells.
LYPLA3 Antibody - BSA Free Western Blot: LYPLA3 Antibody - BSA Free [NBP1-92089]

Western Blot: LYPLA3 Antibody - BSA Free [NBP1-92089]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for LYPLA3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LYPLA3

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities.

Alternate Names

1-O-acylceramide synthase, ACSDKFZp564A0122, EC 2.3.1.43, GXVPLA2, LLPLLCAT-like lysophospholipase, LPLA2group XV phospholipase A2, LYPLA3EC 2.3.1.-, Lysophospholipase 3, lysophospholipase 3 (lysosomal phospholipase A2), Lysosomal phospholipase A2, phospholipase A2, group XV

Gene Symbol

PLA2G15

Additional LYPLA3 Products

Product Documents for LYPLA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LYPLA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LYPLA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LYPLA3 Antibody - BSA Free and earn rewards!

Have you used LYPLA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...