MAP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89483

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261).

Marker

Microtubule Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAP4 Antibody - BSA Free

MAP4 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: MAP4 Antibody - BSA Free [NBP1-89483]

Immunocytochemistry/ Immunofluorescence: MAP4 Antibody - BSA Free [NBP1-89483]

Staining of human cell line A-431 shows localization to plasma membrane, cytosol & microtubules.
MAP4 Antibody - BSA Free Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Staining of human kidney, lymphoid tissues, skeletal muscle and testis using Anti-MAP4 antibody NBP1-89483 (A) shows similar protein distribution across tissues to independent antibody NBP1-85874 (B).
MAP4 Antibody - BSA Free Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
MAP4 Antibody - BSA Free Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
MAP4 Antibody - BSA Free Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
MAP4 Antibody - BSA Free Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Immunohistochemistry-Paraffin: MAP4 Antibody - BSA Free [NBP1-89483]

Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Applications for MAP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAP4

MAP4 is encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed, the full-length nature of three of which are supported.

Alternate Names

DKFZp779A1753, MAP-4, MGC8617, microtubule-associated protein 4

Gene Symbol

MAP4

Additional MAP4 Products

Product Documents for MAP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MAP4 Antibody - BSA Free

Customer Reviews for MAP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAP4 Antibody - BSA Free and earn rewards!

Have you used MAP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...