Mark3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35899

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mark3 (NP_001122390.2).

Sequence:
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Mark3 Antibody - BSA Free

Mark3 Antibody

Immunohistochemistry: Mark3 Antibody [NBP3-35899] -

Immunohistochemistry: Mark3 Antibody [NBP3-35899] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Mark3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Mark3 Antibody

Western Blot: Mark3 Antibody [NBP3-35899] -

Western Blot: Mark3 Antibody [NBP3-35899] - Western blot analysis of lysates from SH-SY5Y cells using Mark3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time:90s.
Mark3 Antibody

Immunohistochemistry: Mark3 Antibody [NBP3-35899] -

Immunohistochemistry: Mark3 Antibody [NBP3-35899] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Mark3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Mark3 Antibody

Western Blot: Mark3 Antibody [NBP3-35899] -

Western Blot: Mark3 Antibody [NBP3-35899] - Western Blot analysis of lysates from SH-SY5Y cells using Mark3 Rabbit pAbat 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time:90s.

Applications for Mark3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Mark3

MARK3 is a dual-specificity protein kinase that controls entry into mitosis by dephosphorylating Cdc2 on both threonine 14 and tyrosine 15. MARK3 is phosphorylated on serine 216 throughout interphase but not during mitosis. Serine 216 phosphorylation mediates the binding of 14-3-3 protein to MARK3, and MARK3/14-3-3 complexes are present throughout interphase but not during mitosis (1). Kinase suppressor of Ras (KSR) is a conserved component of the Ras pathway that interacts directly with MEK and MAPK. It has been shown that KSR1 translocates from the cytoplasm to the cell surface in response to growth factor treatment and that this process is regulated by MARK3 (2). MARK3 seems to be a positive regulator of the beta-catenin pathway and an inhibitor of the JNK pathway. These findings show that MARK3, a regulator of polarity, is also a modulator of Wnt-beta-catenin signalling, indicating a link between two important developmental pathways (3).

Alternate Names

Cdc25C-associated protein kinase 1, cTAK1, C-TAK1, CTAK1ELKL motif kinase 2, EC 2.7.11, EC 2.7.11.1, EMK2, EMK-2, KP78, MAP/microtubule affinity-regulating kinase 3, PAR1A, Protein kinase STK10, Ser/Thr protein kinase PAR-1, Serine/threonine-protein kinase p78

Gene Symbol

MARK3

Additional Mark3 Products

Product Documents for Mark3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Mark3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mark3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mark3 Antibody - BSA Free and earn rewards!

Have you used Mark3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...