MCCC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38403

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCCC2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MCCC2 Antibody - BSA Free

Western Blot: MCCC2 Antibody [NBP2-38403]

Western Blot: MCCC2 Antibody [NBP2-38403]

Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MCCC2 Antibody [NBP2-38403]

Immunocytochemistry/ Immunofluorescence: MCCC2 Antibody [NBP2-38403]

Immunocytochemistry/Immunofluorescence: MCCC2 Antibody [NBP2-38403] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle using Anti-MCCC2 antibody NBP2-38403.
Western Blot: MCCC2 Antibody [NBP2-38403]

Western Blot: MCCC2 Antibody [NBP2-38403]

Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining in human kidney and skeletal muscle tissues using anti-MCCC2 antibody. Corresponding MCCC2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human kidney, liver, skeletal muscle and skin using Anti-MCCC2 antibody NBP2-38403 (A) shows similar protein distribution across tissues to independent antibody NBP1-82794 (B).
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skin.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human liver.
Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403]

Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human kidney using Anti-MCCC2 antibody NBP2-38403.

Applications for MCCC2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCCC2

MCCC2 encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.

Alternate Names

3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta, MCCase subunit beta, MCCBEC 6.4.1.4, methylcrotonoyl-CoA carboxylase 2 (beta), methylcrotonoyl-Coenzyme A carboxylase 2 (beta), mitochondrial, non-biotin containing subunit of 3-methylcrotonyl-CoA carboxylase

Gene Symbol

MCCC2

UniProt

Q9HCC0 (Human)

Additional MCCC2 Products

Product Documents for MCCC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCCC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCCC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCCC2 Antibody - BSA Free and earn rewards!

Have you used MCCC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies