Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92116

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Microsomal Glutathione S-transferase 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining in human liver and skeletal muscle tissues using anti-MGST1 antibody. Corresponding MGST1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunocytochemistry/ Immunofluorescence: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunocytochemistry/Immunofluorescence: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining of human skeletal muscle shows low expression as expected.
Microsomal Glutathione S-transferase 1 Antibody - BSA Free Immunohistochemistry: Microsomal Glutathione S-transferase 1 Antibody - BSA Free [NBP1-92116]

Immunohistochemistry: Microsomal Glutathione S-transferase 1 Antibody - BSA Free [NBP1-92116]

Staining of human liver shows high expression.

Applications for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Microsomal Glutathione S-transferase 1

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. [provided by RefSeq]

Alternate Names

glutathione S-transferase 12, GST12EC 2.5.1.18, MGC14525, MGST, MGST-I, microsomal glutathione S-transferase 1, Microsomal GST-1, Microsomal GST-I

Gene Symbol

MGST1

Additional Microsomal Glutathione S-transferase 1 Products

Product Documents for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Microsomal Glutathione S-transferase 1 Antibody - BSA Free and earn rewards!

Have you used Microsomal Glutathione S-transferase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies