Moesin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90373

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Moesin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Moesin Antibody [NBP1-90373]

Immunocytochemistry/ Immunofluorescence: Moesin Antibody [NBP1-90373]

Immunocytochemistry/Immunofluorescence: Moesin Antibody [NBP1-90373] - Staining of human cell line U-251 MG shows localization to plasma membrane.
Moesin Antibody - BSA Free Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Analysis in human lung and skeletal muscle tissues using NBP1-90373 antibody. Corresponding MSN RNA-seq data are presented for the same tissues.
Moesin Antibody - BSA Free Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Staining of human lung shows moderate membranous positivity in macrophages.
Moesin Antibody - BSA Free Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Moesin Antibody - BSA Free Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Staining of human tonsil shows moderate membranous positivity in germinal center cells.
Moesin Antibody - BSA Free Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Immunohistochemistry: Moesin Antibody - BSA Free [NBP1-90373]

Staining of human kidney shows moderate membranous positivity in cells in tubules.
Western Blot: Moesin Antibody [NBP1-90373]

Western Blot: Moesin Antibody [NBP1-90373]

Western Blot: Moesin Antibody [NBP1-90373] - Analysis in human cell lines U-251MG and MCF-7 using anti-MSN antibody. Corresponding MSN RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Moesin Antibody [NBP1-90373]

Western Blot: Moesin Antibody [NBP1-90373]

Western Blot: Moesin Antibody [NBP1-90373] - Analysis using Anti-MSN antibody NBP1-90373 (A) shows similar pattern to independent antibody NBP1-90372 (B).
Moesin Antibody - BSA Free Western Blot: Moesin Antibody - BSA Free [NBP1-90373]

Western Blot: Moesin Antibody - BSA Free [NBP1-90373]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for Moesin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Moesin

Moesin (membrane-organizing extension spike protein) has previously been characterized as a possible receptor protein for heparan sulfate and also as a cytoskeletal linker protein that stabilizes cell surface microvilli, filopodia and lamellipodia. Data indicate that moesin is identical to the 77-kDa band that copurifies with ezrin in its isolation from human placenta (1). Members of the ezrin-radixin-moesin (ERM) family of membrane-cytoskeletal linking proteins have NH2- and COOH-terminal domains that associate with the plasma membrane and the actin cytoskeleton, respectively (2). It has been demonstrated that ezrin-radixin-moesin proteins are rapidly inactivated after antigen recognition through a Vav1-Rac1 pathway. The resulting disanchoring of the cortical actin cytoskeleton from the plasma membrane decreased cellular rigidity, leading to more efficient T cell-antigen-presenting cell conjugate formation (3).

Alternate Names

Membrane-organizing extension spike protein, moesin

Gene Symbol

MSN

Additional Moesin Products

Product Documents for Moesin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Moesin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Moesin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Moesin Antibody - BSA Free and earn rewards!

Have you used Moesin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Moesin Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking to use shRNA to inhibit Moesin expression. I have had people advise me that my initial MOI should be low as 'less is more' and 'a little goes a long way' in terms of siRNA. I was wondering if you could elaborate on this for me and explain why my initial MOI should be low.

    A: The reason for a low MOI is most likely because RNAi is a very strong and efficient technique. Wikipedia does a good job of explaining RNA interference. However, I would imagine that in a cell, there will be at most 1-2 copies of the gene mRNA present at any given time, unless you're dealing with a highly expressed protein such as Actin, where I would imagine silencing Actin would be lethal to the cell. I can imagine a few reasons to not use too much siRNA. First, it is expensive, so you don't want to waste it. Second, using too much would cause there to be a lot of non-translatable RNA present in the cell, which could trigger an immune response, as the presence of uncapped RNAs can indicate presence of a virus and one of the TLRs may respond to this.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...