MSH6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83319

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MSH6 Antibody - BSA Free

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human fallopian tube, liver, lymph node and testis using Anti-MSH6 antibody NBP1-83319 (A) shows similar protein distribution across tissues to independent antibody NBP1-83318 (B).
Immunocytochemistry/ Immunofluorescence: MSH6 Antibody [NBP1-83319]

Immunocytochemistry/ Immunofluorescence: MSH6 Antibody [NBP1-83319]

Immunocytochemistry/Immunofluorescence: MSH6 Antibody [NBP1-83319] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319]

Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.
MSH6 Antibody - BSA Free Western Blot: MSH6 Antibody - BSA Free [NBP1-83319]

Western Blot: MSH6 Antibody - BSA Free [NBP1-83319]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))
MSH6 Antibody - BSA Free Western Blot: MSH6 Antibody - BSA Free [NBP1-83319]

Western Blot: MSH6 Antibody - BSA Free [NBP1-83319]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for MSH6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MSH6

MSH6 is a mismatch-repair protein. It plays a role in tumor suppression. Genomic mutations in MSH6 predispose to the hereditary non-polyposis colorectal cancer (HNPCC) syndrome.

Alternate Names

DNA mismatch repair protein Msh6, G/T mismatch-binding protein, GTBPHNPCC5, GTMBP, hMSH6, HSAP, mutS (E. coli) homolog 6, mutS homolog 6 (E. coli), MutS-alpha 160 kDa subunit, p160, sperm-associated protein

Gene Symbol

MSH6

Additional MSH6 Products

Product Documents for MSH6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MSH6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MSH6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MSH6 Antibody - BSA Free and earn rewards!

Have you used MSH6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MSH6 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am testing a mouse sample with human xenograft for GBM and I am looking for an MSH6 Antibody that will only detect the human cells.

    A: Currently, we have no validation that any of our MSH6 antibodies will not cross react with mouse. All of our MSH6 Antibodies are raised against Human MSH6 so we have checked the % homology with mouse MSH6 which has come to be 85%. As 85% is very high, the chances of the antibody detecting the mouse tissue as well as the human tissue are high.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...