MTGR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34136

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MTGR1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTGR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136]

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136]

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining in human testis and liver tissues using anti-CBFA2T2 antibody. Corresponding CBFA2T2 RNA-seq data are presented for the same tissues.
Western Blot: MTGR1 Antibody [NBP2-34136]

Western Blot: MTGR1 Antibody [NBP2-34136]

Western Blot: MTGR1 Antibody [NBP2-34136] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136]

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136]

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136]

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136]

Immunohistochemistry-Paraffin: MTGR1 Antibody [NBP2-34136] - Staining of human testis shows high expression.

Applications for MTGR1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTGR1

In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described.

Alternate Names

core-binding factor, runt domain, alpha subunit 2; translocated to, 2, EHTDKFZp313F2116, ETO homolog on chromosome 20, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1p85, myeloid translocation gene-related protein 1, Myeloid translocation-related protein 1, protein CBFA2T2, ZMYND3

Gene Symbol

CBFA2T2

UniProt

O43439 (Human)

Additional MTGR1 Products

Product Documents for MTGR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTGR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTGR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTGR1 Antibody - BSA Free and earn rewards!

Have you used MTGR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies