MVP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82820

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MVP Antibody - BSA Free

Western Blot: MVP Antibody [NBP1-82820]

Western Blot: MVP Antibody [NBP1-82820]

Western Blot: MVP Antibody [NBP1-82820] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/ Immunofluorescence: MVP Antibody [NBP1-82820]

Immunocytochemistry/ Immunofluorescence: MVP Antibody [NBP1-82820]

Immunocytochemistry/Immunofluorescence: MVP Antibody [NBP1-82820] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Simple Western: MVP Antibody [NBP1-82820]

Simple Western: MVP Antibody [NBP1-82820]

Simple Western: MVP Antibody [NBP1-82820] - Electropherogram image(s) of corresponding Simple Western lane view. MVP antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).
Simple Western: MVP Antibody [NBP1-82820]

Simple Western: MVP Antibody [NBP1-82820]

Simple Western: MVP Antibody [NBP1-82820] - Simple Western lane view shows a specific band for MVP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
MVP Antibody

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] -

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
MVP Antibody

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] -

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.
MVP Antibody

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] -

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
MVP Antibody

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] -

Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for MVP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Simple Western

1:30

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 112 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MVP

MVP encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.

Alternate Names

LRPVAULT1, Lung resistance-related protein, major vault protein

Gene Symbol

MVP

Additional MVP Products

Product Documents for MVP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MVP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MVP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MVP Antibody - BSA Free and earn rewards!

Have you used MVP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MVP Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?

    A: At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Has NBP1-82820 been shown not to react with mouse tissue?

    A:

    NBP1-82820 has been tested in human only, however the antigen sequence identity between human and mouse is 91% so reactivity with mouse is likely. If you would be interested in testing this novel species, please take a look at our Innovators Reward Program.

  • Q: Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?

    A: At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

  • Q: Has NBP1-82820 been shown not to react with mouse tissue?

    A:

    NBP1-82820 has been tested in human only, however the antigen sequence identity between human and mouse is 91% so reactivity with mouse is likely. If you would be interested in testing this novel species, please take a look at our Innovators Reward Program.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...