N-WASP Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82512
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for N-WASP Antibody - BSA Free
Western Blot: N-WASP Antibody [NBP1-82512]
Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunocytochemistry/ Immunofluorescence: N-WASP Antibody [NBP1-82512]
Immunocytochemistry/Immunofluorescence: N-WASP Antibody [NBP1-82512] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.Western Blot: N-WASP Antibody [NBP1-82512]
Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in human cell line RT-4.Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human kidney shows moderate to strong positivity in cells in tubules and glomeruli.Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human skeletal muscle shows weak positivity in myocytes.Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512]
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human stomach shows moderate to strong positivity in glandular cells.Simple Western: N-WASP Antibody [NBP1-82512]
Simple Western: N-WASP Antibody [NBP1-82512] - Simple Western lane view shows a specific band for N-WASP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Western Blot: N-WASP Antibody [NBP1-82512] -
Western Blot: N-WASP Antibody [NBP1-82512] - Generation of nWASP knockdown cell lines. A-549 & SK-MES-1 cells were treated with nWASP siRNA/non-targeting siRNA (NT) at 0.5 μg/ml & then analysed for nWASP expression after 48 h. a QPCR analysis of nWASP transcript expression demonstrates a significant decrease in expression in siRNA treated cells, n = 4 replicates. b PCR also demonstrates a decrease in nWASP expression. c Quantitative analysis of Western blots (n = 4) shows significant decrease in nWASP protein expression in both A-549 & SK-MES1 cell lines after 48 h siRNA treatment. d Representative image showing knockdown of nWASP at protein level in siRNA treated cells at 48 h Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28351346), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: N-WASP Antibody [NBP1-82512] -
Western Blot: N-WASP Antibody [NBP1-82512] - nWASP activity affects A-549 & SK-MES-1 cell growth. a, b nWASP inhibition using 10 μM wiskostatin treatment significantly impairs the growth of A-549 & SK-MES-1 cells, respectively. c, d A significant effect on growth is also evident after 3 days in nWASP knockdown A-549 & SK-MES-1 cells, respectively, when compared to non-targeting control treated cells Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28351346), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: N-WASP Antibody - BSA Free [NBP1-82512] -
N-WASP and TOCA-1 play a role in C.t. pedestal-like structure formation. (A) N-WASP and TOCA-1 were knocked down in HeLa cells. Knockdown was verified using Western blotting, probing with anti-GAPDH, anti-N-WASP, and anti-TOCA-1 antibodies and quantified using densitometry, with relative density or adjusted relative density shown under the blots. Relative density was determined compared to mock KD, and relative density was adjusted for the N-WASP and TOCA-1 blots compared to the GAPDH standards. (B) HeLa cells were asynchronously infected with WTL2 at an MOI of 50 for 15 minutes and imaged with transmission electron microscopy; three representative images are shown. (C) Quantification of EBs associated with pedestal-like structures. A total of 100 EBs per experiment were assessed from two separate experiments, in which images were blinded and categorized as associated or not associated with pedestal-like structures. EBs associated with pedestal-like structures were compared to total EBs to determine the percentage associated with pedestal-like structures. Data represent the mean of two biological replicates. Error bars represent SD, *P < 0.05. Significance was determined using one-way ANOVA followed by Tukey’s multiple comparisons test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40231845), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for N-WASP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin, HIER pH6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 77 kDa
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: N-WASP
Long Name
Neural Wiskott-Aldrich Syndrome Protein
Alternate Names
NWASP, TRS4, WASL
Gene Symbol
WASL
Additional N-WASP Products
Product Documents for N-WASP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for N-WASP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for N-WASP Antibody - BSA Free
Customer Reviews for N-WASP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review N-WASP Antibody - BSA Free and earn rewards!
Have you used N-WASP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...