NDUFA4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93390

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1). MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFA4 Antibody - Azide and BSA Free

NDUFA4 Antibody - Azide and BSA Free

Western Blot: NDUFA4 Antibody - Azide and BSA Free [NBP2-93390] -

Western Blot: NDUFA4 Antibody - Azide and BSA Free [NBP2-93390] - Western blot analysis of lysates from U-251 MG cells using NDUFA4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
NDUFA4 Antibody - Azide and BSA Free

Immunohistochemistry: NDUFA4 Antibody - Azide and BSA Free [NBP2-93390] -

Immunohistochemistry: NDUFA4 Antibody - Azide and BSA Free [NBP2-93390] - Immunohistochemistry analysis of paraffin-embedded human liver using NDUFA4 Rabbit pAb at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for NDUFA4 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:500-1:2000

Reviewed Applications

Read 1 review rated 1 using NBP2-93390 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFA4

NDUFA4 is encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Alternate Names

CI-9k, CI-MLRQ, Complex I 9kDa subunit, Complex I-MLRQ, FLJ27440, MGC104422, MGC126843, MGC126845, MLRQ, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4, NADH-ubiquinone oxidoreductase MLRQ subunit

Gene Symbol

NDUFA4

Additional NDUFA4 Products

Product Documents for NDUFA4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFA4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for NDUFA4 Antibody - Azide and BSA Free

Customer Reviews for NDUFA4 Antibody - Azide and BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used NDUFA4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • NDUFA4 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: human brain lysate
    Species: Human
    Verified Customer | Posted 04/06/2023
    NDUFA4 Antibodies NBP2-93390, ProteinSimple Western Blot on Jess Instrument; 3 and 1microgram of human brain tissue lysate was tested with the antibodies diluted 10 times. No specific signal was detected at any exposure.
    NDUFA4 Antibody - Azide and BSA Free NBP2-93390
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...