NDUFB8 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NDUFB8 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 29-186 of human NDUFB8 (NP_004995.1). ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFB8 Antibody - Azide and BSA Free

Western Blot: NDUFB8 AntibodyAzide and BSA Free [NBP3-16016]

Western Blot: NDUFB8 AntibodyAzide and BSA Free [NBP3-16016]

Western Blot: NDUFB8 Antibody [NBP3-16016] - Western blot analysis of extracts of various cell lines, using NDUFB8 antibody (NBP3-16016) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody [NBP3-16016] - Immunofluorescence analysis of U2OS cells using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunohistochemistry-Paraffin: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP3-16016] - Immunohistochemistry of paraffin-embedded mouse kidney using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody [NBP3-16016] - Immunofluorescence analysis of A-549 cells using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody [NBP3-16016] - Immunofluorescence analysis of NIH/3T3 cells using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunohistochemistry-Paraffin: NDUFB8 Antibody - Azide and BSA Free [NBP3-16016]

Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP3-16016] - Immunohistochemistry of paraffin-embedded human liver using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for NDUFB8 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFB8

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit

Gene Symbol

NDUFB8

Additional NDUFB8 Products

Product Documents for NDUFB8 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFB8 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NDUFB8 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NDUFB8 Antibody - Azide and BSA Free and earn rewards!

Have you used NDUFB8 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies