Neogenin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89651
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse, Rat
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Neogenin Antibody - BSA Free
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human placenta shows no positivity in trophoblastic cells as expected.Western Blot: Neogenin Antibody - BSA Free [NBP1-89651] -
Expression profiling of spermatogonial stem cell markers in control and neogenin-cKO testes. Neogenin was conditionally knocked out in the mouse testis by CRISPR-Cas9 as described in the Materials and Methods. (A) Quantitative real-time PCR analysis of relative mRNA expression of neogenin, Oct3/4, Sox2, and Nanog normalized against that of beta -actin. (n = 3) (B) Proteins extracted from testicular tissues at postnatal day 26 were analyzed by Western blotting. beta -actin was used as a housekeeping protein. Con: control testis; Neo cKO: neogenin conditional knock-out testis. Data are the mean +/- SD of triplicates. * p < 0.05 and *** p < 0.001 versus control by the Student’s t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499089), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Neogenin Antibody - BSA Free [NBP1-89651] -
An ELISA of PGD2 in human follicular fluid and the culture medium of RGMc-treated CCs. (a) The PGD2 level in follicular fluid of patients with a POR and young and old patients with a normal ovarian response. (b,c) The ELISA data of PGD2 level in the culture media of RGMc-treated CCs obtained from (b) patients with a normal ovarian response and (c) patients with a POR. (d) Gene expression of neogenin in human CCs of normal and POR patients. All assays were repeated three times with different samples for statistical analysis. * p < 0.05 and *** p < 0.001 versus the young and old normal ovarian response groups. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33801938), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Neogenin Antibody - BSA Free [NBP1-89651] -
Involvement of RGMa in the osteogenic transdifferentiation of VSMCs in vitro. (A) Representative images of Alizarin red S staining and magnification. Red is the positive signal of calcification labelled by alizarin. (B) Representative images of RGMa and alpha -SMA immunofluorescence double labelling. alpha -SMA (green); RGMa (red). Scale bar = 50 μm. (C–I) Representative WB images of RGMa, Neogenin and vascular smooth muscle osteogenic transdifferentiation -related markers (C) and quantitative analysis of RGMa (D), Neogenin (E), Runx2 (F), BMP2 (G), alpha -SMA (H), SM22 alpha (I). n=6 per group, ns indicates not significant, *P < 0.05, **P < 0.01, ***P < 0.001, one-way ANOVA. Original blots/gels are available in Supplementary Figure S3. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40634394), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Neogenin Antibody [NBP1-89651]
Staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.Applications for Neogenin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Neogenin
Alternate Names
NEO, NEO1, NGN
Gene Symbol
NEO1
Additional Neogenin Products
Product Documents for Neogenin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Neogenin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Neogenin Antibody - BSA Free
Customer Reviews for Neogenin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Neogenin Antibody - BSA Free and earn rewards!
Have you used Neogenin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...