NIFK Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48642

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NIFK Antibody - BSA Free

Western Blot: NIFK Antibody [NBP2-48642]

Western Blot: NIFK Antibody [NBP2-48642]

Western Blot: NIFK Antibody [NBP2-48642] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: NIFK Antibody [NBP2-48642]

Immunocytochemistry/ Immunofluorescence: NIFK Antibody [NBP2-48642]

Immunocytochemistry/Immunofluorescence: NIFK Antibody [NBP2-48642] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
NIFK Antibody - BSA Free Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Staining of human small intestine shows strong nucleolar positivity in glandular cells.
NIFK Antibody - BSA Free Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.
NIFK Antibody - BSA Free Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Staining of human cervix shows strong nucleolar positivity in squamous epithelial cells.
NIFK Antibody - BSA Free Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642]

Staining of human fallopian tube shows strong nucleolar positivity in glandular cells.

Applications for NIFK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NIFK

NIFK is a nucleolar protein that interacts with Ki67, a protein strongly associated with, and a specific marker of, cell proliferation. The marsupial counterpart of human NIFK was recently identified and suggests that NIFK may be involved in the organization of higher order chromatin structure. NIFK was found to interact with the forkhead associated domain of Ki67 in mitotic cells and the interaction is thought to be phosphorylation-dependent.

Alternate Names

hNIFK, MKI67 (FHA domain) interacting nucleolar phosphoprotein, MKI67 FHA domain-interacting nucleolar phosphoprotein, NIFKNOPP34, Nopp34, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67

Gene Symbol

NIFK

Additional NIFK Products

Product Documents for NIFK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NIFK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NIFK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NIFK Antibody - BSA Free and earn rewards!

Have you used NIFK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...