NIPP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90112

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: THSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NIPP1 Antibody - BSA Free

NIPP1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: NIPP1 Antibody - BSA Free [NBP1-90112]

Immunocytochemistry/ Immunofluorescence: NIPP1 Antibody - BSA Free [NBP1-90112]

Staining of human cell line A-431 shows localization to nuclear speckles.
NIPP1 Antibody - BSA Free Western Blot: NIPP1 Antibody - BSA Free [NBP1-90112]

Western Blot: NIPP1 Antibody - BSA Free [NBP1-90112]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: NIPP1 Antibody [NBP1-90112]

Western Blot: NIPP1 Antibody [NBP1-90112]

Western Blot: NIPP1 Antibody [NBP1-90112] - Analysis using Anti-PPP1R8 antibody NBP1-90112 (A) shows similar pattern to independent antibody NBP1-90113 (B).
NIPP1 Antibody - BSA Free Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Staining of human testis.
NIPP1 Antibody - BSA Free Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Staining of human lymph node.
NIPP1 Antibody - BSA Free Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Staining of human cerebral cortex.
NIPP1 Antibody - BSA Free Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Staining of human colon.
NIPP1 Antibody - BSA Free Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112]

Staining of human cerebral cortex, colon, lymph node and testis HPA027417 (A) shows similar protein distribution across tissues to independent antibody HPA027406 (B).

Applications for NIPP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NIPP1

NIPP1, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Long Name

Nuclear Inhibitor of Protein Phosphatase 1

Alternate Names

ARD1, PPP1R8, PRO2047, RNase E

Gene Symbol

PPP1R8

Additional NIPP1 Products

Product Documents for NIPP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NIPP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for NIPP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NIPP1 Antibody - BSA Free and earn rewards!

Have you used NIPP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NIPP1 Antibody - BSA Free

Showing  1 - 2 的 2 FAQs Showing All
  • Q: Could you please send me the exact immunogen sequence for NBP1-56106?

    A: The immunogen sequence for NBP1-56106 is proprietary and cannot be disclosed. Please note that this antibody has been validated and is therefore guaranteed for use in human, mouse and rat.

  • Q: Does NBP1-56106 recognize all 3 NIPP1 isoforms?

    A: We have not tested the antibody for specificity of different isoforms of the protein, it recognizes total endogenous NIPP1 protein.

  • Q: Could you please send me the exact immunogen sequence for NBP1-56106?

    A: The immunogen sequence for NBP1-56106 is proprietary and cannot be disclosed. Please note that this antibody has been validated and is therefore guaranteed for use in human, mouse and rat.

  • Q: Does NBP1-56106 recognize all 3 NIPP1 isoforms?

    A: We have not tested the antibody for specificity of different isoforms of the protein, it recognizes total endogenous NIPP1 protein.

Showing  1 - 2 的 2 FAQs Showing All
View all FAQs for Antibodies
Loading...