NKX2.2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82554
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Chromatin Immunoprecipitation
Cited:
Knockout Validated, Immunohistochemistry-Paraffin, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for NKX2.2 Antibody - BSA Free
Western Blot: NKX2.2 Antibody [NBP1-82554]
Western Blot: NKX2.2 Antibody [NBP1-82554] - Analysis in human cell line U-138 MG.Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554]
Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554] - Staining of human cerebellum shows moderate postivity in cells in molecular layer.Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554]
Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554] - Staining of human pancreas shows strong nuclear positivity in islet cells.Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554]
Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554] - Staining of human cerebral cortex shows strong nuclear postivity in glial cells.Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554]
Immunohistochemistry-Paraffin: NKX2.2 Antibody [NBP1-82554] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Chromatin Immunoprecipitation ChIP: NKX2.2 Antibody - BSA Free
ChIP-Exo-Seq composite graph for Anti-NKX2.2 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.Applications for NKX2.2 Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation
1-10µg per reaction
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 2 reviews rated 4 using NBP1-82554 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NKX2.2
Long Name
NK2 Homeobox 2
Alternate Names
NKX2B
Entrez Gene IDs
4821 (Human)
Gene Symbol
NKX2-2
UniProt
Additional NKX2.2 Products
Product Documents for NKX2.2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NKX2.2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for NKX2.2 Antibody - BSA Free
Customer Reviews for NKX2.2 Antibody - BSA Free (2)
4 out of 5
2 Customer Ratings
Have you used NKX2.2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 的
2 reviews
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: Optic nerveSpecies: FelineVerified Customer | Posted 06/23/2017DAPI(Blue) NBP1-82554(red). Tried 1:50-1:500 concentration. Showed extracelluar, cytoplasmic and nuclear staining.4%PFA fixed tissue
-
Application: Immunohistochemistry-FrozenSample Tested: Mouse pancreas in OCTSpecies: MouseVerified Customer | Posted 11/09/2016Staining of Nkx2.2 in mouse pancreas tissue (OCT embed) 1:500 Nkx2.2; 1:1000 Insulin; 1:2000 Glucagon
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars