non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free
Novus Biologicals | Catalog # H00004627-M03
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Bovine
Cited:
Bovine
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 2B3
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Specificity
MYH9 (2B3)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3. Lane 1: MYH9 transfected lysate (Predicted MW: 10.01 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Bovine ovarian granulosa cells. Anti Myosin IIA immunofluorescent staining (green). DNA in counterstained with DAPI (blue). Control was obtained by omitting the primary antibody. Fixation: 4% PF for 7 minutes at rt. Permeabilization: 0.1% Triton-X in PBS for 7 minutes. Blocking: 20% donkey serum, 1% BSA in PBS, 1 hour at rt. Primary antibody: 1:50 or 1:100 in 1% BSA/PBS over night at 4C. Secondary antibody: donkey anti mouse -Alexa 488 (Invitrogen), 1:500. DNA Counterstaining: mounting medium with DAPI. Negative CTRL was performed by omitting the primary antibody, images were captured under an epifluorescence microscope. Image from verified customer review.Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 0.5 ug/mlWestern Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in HeLa.Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in human kidney.Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on HeLa cell. Antibody concentration 10 ug/mlELISA: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03]
ELISA: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.Applications for non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 review rated 5 using H00004627-M03 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Non-muscle Myosin IIA
Long Name
Myosin-9
Alternate Names
MYH9, NMMHC II-a, NMMHC-A, NMMHC-IIA
Entrez Gene IDs
4627 (Human)
Gene Symbol
MYH9
OMIM
153640 (Human)
Additional Non-muscle Myosin IIA Products
Product Documents for non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free
Customer Reviews for non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free (1)
5 out of 5
1 Customer Rating
Have you used non-muscle Myosin IIA Antibody (2B3) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: immunofluorescence on in vitro grown cellsSample Tested: granulosa (ovarian) cells plated and grown on coverglassess, ovarian granulosa cells and bovine ovarian granulosa cellsSpecies: BovineVerified Customer | Posted 06/22/2018Anti Myosin IIA immunofluorescent staining (green). DNA in counterstained with DAPI (blu). Control was obtained by omitting the primary antibodyUnvalidated Species tested: cow Sample: granulosa (ovarian) cells plated and grown on coverglassess Protocol: fixation: 4% PF for 7 minutes at rt permeabilization: 0.1% Triton-X in PBS for 7 minutes. Blocking: 20% donkey serum, 1% BSA in PBS, 1 hour at rt Primary antibody: Mouse Monoclonal non-muscle Myosin IIA Antibody (2B3) 1:50 or 1:100 in 1% BSA/PBS over night at 4°C Secondary antibody: donkey anti mouse -Alexa 488 (Invitrogen), 1:500 DNA Counterstaining: mounting medium with DAPI Negative CTRL was performed by omitting the primary antibody, images were captured under an epifluorescence microscope using the exposure settings Result: the antibody gives a good signal at both concentration tested
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...