NUAK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81880

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Biological Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT

Reactivity Notes

Rat (81%). Use in Mouse reported in scientific literature (PMID:31350328).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUAK2 Antibody - BSA Free

Western Blot: NUAK2 Antibody [NBP1-81880]

Western Blot: NUAK2 Antibody [NBP1-81880]

NUAK2-Antibody-Western-Blot-NBP1-81880-img0017.jpg
Immunocytochemistry/ Immunofluorescence: NUAK2 Antibody [NBP1-81880]

Immunocytochemistry/ Immunofluorescence: NUAK2 Antibody [NBP1-81880]

Immunocytochemistry/Immunofluorescence: NUAK2 Antibody [NBP1-81880] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Western Blot: NUAK2 Antibody [NBP1-81880]

Western Blot: NUAK2 Antibody [NBP1-81880]

Western Blot: NUAK2 Antibody [NBP1-81880] - Analysis in control (vector only transfected HEK293T lysate) and NUAK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]

Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.
Knockdown Validated: NUAK2 Antibody [NBP1-81880]

Western Blot: NUAK2 Antibody [NBP1-81880]

NUAK2-Antibody-Knockdown-Validated-NBP1-81880-img0016.jpg
NUAK2 Antibody

Western Blot: NUAK2 Antibody [NBP1-81880] -

Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 activity is involved in serum-induced or LPA-induced YAP/TAZ dephosphorylation & activation. a, b FBS & LPA activate YAP/TAZ & induce NUAK2 expression. YAP/TAZ phosphorylation status was monitored using Phos-Tag gels (a), while NUAK2 & ANKRD1 mRNA expression was determined by qPCR at the indicated times. Expression data are plotted as the mean ± SD (n = 3). c–h WZ4003 (10 μM) blocks serum/LPA-induced NUAK2 & ANKRD1 mRNA expression. FBS-induced or LPA-induced YAP/TAZ dephosphorylation (e & g), or NUAK2 & ANKRD1 mRNA expression (c, f, h) was monitored at the indicated times (d). Expression data are plotted as the mean ± range for a representative experiment (c, f, h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUAK2 Antibody

Western Blot: NUAK2 Antibody [NBP1-81880] -

Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUAK2 Antibody

Western Blot: NUAK2 Antibody [NBP1-81880] -

Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUAK2 Antibody

Western Blot: NUAK2 Antibody [NBP1-81880] -

Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 is associated with high-grade human bladder cancer. a, c Expression of NUAK2 & the YAP Signature Genes (YAP SG) is enhanced both in high-grade non-muscle-invasive (HG-NMIBC; n = 13, **p = 0.0071) & muscle-invasive (pT2 MIBC; n = 9, **p = 0.0033) bladder cancers39 as compared to LG-NMIBC (n = 27) using an unpaired t test. b Elevated expression of NUAK2 is correlated with disease recurrence in a cohort41 of MIBC patient samples with n = 57 disease free & n = 56, recurred samples (*p = 0.0172). Box & whisker plots show the median (line in the box), first & third quartiles (lower & upper ends of the box), & the minimum & maximum values (whiskers in the plot). Dots represent a single patient sample. d A heat map depicting expression of NUAK2 & YAP SG in NMIBC LG (open circle), HG (closed circle), & MIBC pT2 (slashed circle) bladder cancer samples39. e Characterization of high-grade-derived & low-grade-derived bladder cancer cell lines. Scale bar, 25 μm. f NUAK2 mRNA expression is elevated in HG-derived (TCCSUP & T24) BC cell lines as compared to LG lines. Data are plotted as the mean ± SD (n = 3). g–i Blocking NUAK2 activity with 10 μM WZ4003 (g) or NUAK2 expression in stable clones (#5 or #7) using inducible NUAK2 shRNAs (h, i) inhibits the growth of HG BC cell lines as measured by SRB (g) or DAPI (h) staining. Data are plotted as the mean ± SD of a representative experiment, n = 3 (for TCC) or mean ± range of two experiments (for T24) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NUAK2 Antibody

Western Blot: NUAK2 Antibody [NBP1-81880] -

Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NUAK2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUAK2

Stress-activated kinase involved in tolerance to glucose starvation. Induces cell-cell detachment byincreasing F-actin conversion to G-actin. Expression is induced by CD95 or TNF-alpha, via NF-kappa-B. Protects cellsfrom CD95-mediated apoptosis and is required for the increased motility and invasiveness of CD95-activated tumor cells

Long Name

NUAK family SNF1-like kinase 2

Alternate Names

OMPHK2, SNARK

Entrez Gene IDs

81788 (Human)

Gene Symbol

NUAK2

UniProt

Additional NUAK2 Products

Product Documents for NUAK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUAK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NUAK2 Antibody - BSA Free

Customer Reviews for NUAK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUAK2 Antibody - BSA Free and earn rewards!

Have you used NUAK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...