Nucleolar Protein 4 Like Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-94114

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nucleolar Protein 4 Like Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunocytochemistry/ Immunofluorescence: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunocytochemistry/Immunofluorescence: C20orf112 Antibody [NBP1-94114] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human cerebral cortex.
Immunohistochemistry: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry: C20orf112 Antibody [NBP1-94114] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining in human testis and endometrium tissues using anti-NOL4L antibody. Corresponding NOL4L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human cerebral cortex, colon, kidney and testis using Anti-NOL4L antibody NBP1-94114 (A) shows similar protein distribution across tissues to independent antibody NBP1-94115 (B).
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human colon.
Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: Nucleolar Protein 4 Like Antibody [NBP1-94114]

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human kidney.

Applications for Nucleolar Protein 4 Like Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nucleolar Protein 4 Like

Alternate Names

hypothetical protein LOC100506597, LOC100506597

Gene Symbol

C20orf112

Additional Nucleolar Protein 4 Like Products

Product Documents for Nucleolar Protein 4 Like Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nucleolar Protein 4 Like Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nucleolar Protein 4 Like Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nucleolar Protein 4 Like Antibody - BSA Free and earn rewards!

Have you used Nucleolar Protein 4 Like Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...