OSR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35813

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 28-115 of human OSR1 (NP_660303.1).

Sequence:
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OSR1 Antibody - BSA Free

OSR1 Antibody

Immunohistochemistry: OSR1 Antibody [NBP3-35813] -

Immunohistochemistry: OSR1 Antibody [NBP3-35813] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using OSR1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
OSR1 Antibody

Immunohistochemistry: OSR1 Antibody [NBP3-35813] -

Immunohistochemistry: OSR1 Antibody [NBP3-35813] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using OSR1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
OSR1 Antibody

Immunohistochemistry: OSR1 Antibody [NBP3-35813] -

Immunohistochemistry: OSR1 Antibody [NBP3-35813] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using OSR1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
OSR1 Antibody

Western Blot: OSR1 Antibody [NBP3-35813] -

Western Blot: OSR1 Antibody [NBP3-35813] - Western blot analysis of various lysates using OSR1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.

Applications for OSR1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: OSR1

OXSR1 is a serine/threonine kinase which regulates downstream kinases in response to environmental stress such as osmotic stresses. It may have a role in regulating the actin cytoskeleton.

Alternate Names

ODDodd-skipped (Drosophila) homolog, odd-skipped homolog, odd-skipped related 1 (Drosophila), protein odd-skipped-related 1

Gene Symbol

OSR1

Additional OSR1 Products

Product Documents for OSR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OSR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OSR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OSR1 Antibody - BSA Free and earn rewards!

Have you used OSR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...