PABPC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13722

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PABPC4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: RPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PABPC4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Analysis in human skeletal muscle and liver tissues using NBP2-13722 antibody. Corresponding PABPC4 RNA-seq data are presented for the same tissues.
Western Blot: PABPC4 Antibody [NBP2-13722]

Western Blot: PABPC4 Antibody [NBP2-13722]

Western Blot: PABPC4 Antibody [NBP2-13722] - Analysis using Anti-PABPC4 antibody NBP2-13722 (A) shows similar pattern to independent antibody NBP2-58575 (B).
Immunocytochemistry/ Immunofluorescence: PABPC4 Antibody [NBP2-13722]

Immunocytochemistry/ Immunofluorescence: PABPC4 Antibody [NBP2-13722]

Immunocytochemistry/Immunofluorescence: PABPC4 Antibody [NBP2-13722] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.
Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722]

Immunohistochemistry-Paraffin: PABPC4 Antibody [NBP2-13722] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Applications for PABPC4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PABPC4

Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules.

Alternate Names

APP1FLJ43938, APP-1PABP-4, Inducible poly(A)-binding protein, IPABP, iPABPpoly(A)-binding protein, cytoplasmic 4 (inducible form), PABP4Activated-platelet protein 1, poly(A) binding protein, cytoplasmic 4 (inducible form), Poly(A)-binding protein 4, polyadenylate-binding protein 4

Gene Symbol

PABPC4

Additional PABPC4 Products

Product Documents for PABPC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PABPC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PABPC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PABPC4 Antibody - BSA Free and earn rewards!

Have you used PABPC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies