Pannexin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59672

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PANX1(pannexin 1) The peptide sequence was selected from the middle region of PANX1. Peptide sequence LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Pannexin-1 Antibody - BSA Free

Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672] - Human Jurkat cell lysate Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672]

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672]

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Paraffin Embedded Tissue: Human neural cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672] - Tissue: Hela whole cell lysates
Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672] - PANX1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate
Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672]

Western Blot: Pannexin-1 Antibody [NBP1-59672] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672]

Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672]

Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672] - Mouse Retina and Knockout PANX-1 Mouse Tissue.
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672]

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672]

Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Intestine

Applications for Pannexin-1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pannexin-1

PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Alternate Names

Innexin, MRS1, Pannexin1, PANX1, PX1

Gene Symbol

PANX1

UniProt

Additional Pannexin-1 Products

Product Documents for Pannexin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pannexin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pannexin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pannexin-1 Antibody - BSA Free and earn rewards!

Have you used Pannexin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies