PARD3/Par3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88861

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PARD3/Par3 Antibody - BSA Free

Western Blot: PARD3/Par3 Antibody [NBP1-88861]

Western Blot: PARD3/Par3 Antibody [NBP1-88861]

Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Simple Western: PARD3/Par3 Antibody [NBP1-88861]

Simple Western: PARD3/Par3 Antibody [NBP1-88861]

Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a specific band for PARD3/Par3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining PARD3 in mouse trophoblast stem cells. Verified customer review from 1DegreeBio.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human colon shows distinct luminal membranous positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

PARD3-Par3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88861-img0023.jpg
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human skin shows weak to moderate cytoplasmic positivity in epidermal cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861]

Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line 8505C cells (anaplastic thyroid cancer cell line). Image from verified customer review.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human kidney shows weak to moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cerebellum shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861]

Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human fallopian tube shows weak to moderate positivity in luminal membrane in glandular cells.
Simple Western: PARD3/Par3 Antibody [NBP1-88861]

Simple Western: PARD3/Par3 Antibody [NBP1-88861]

Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corresponding Simple Western lane view. PARD3/Par3 antibody was used at 1:100 dilution on RT-4 lysate(s).
PARD3/Par3 Antibody

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] -

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 is localized asymmetrically at the tip of the cell. (B) The VANGL2 enriched tip of the cell is marked by MSN. (C) In MCAM knockout C164 cells myotube elongation fails, MSN labels the whole plasma membrane & VANGL2 is spread across the cytoplasm. (D) Highly polarized localization of MCAM & SCRIB at the distal end of growing wild-type myotube. Separate channels of the boxed area are shown on the right. (E) In MCAM knockout cells SCRIB levels remain low & it is spread evenly in the cell. (F) In wild-type myotubes PAR3 remains cytoplasmic, whereas (G) in MCAM knockout C164 cells it can be detected at the cell cortex. (H) RT-qPCR demonstrates reduced expression of Scrib in MCAM mutant cell lines. Cells were treated for 7 days with BMP2 or testosterone (n=3; **P<0.01; ***P<0.001; two-tailed t-test; mean±s.e.m.). (I) Deletion of MCAM endocytosis motif leads to similar polarity defects as complete MCAM elimination. VANGL2 is evenly spread in U125 cells & PAR3 accumulates in cell cortex. (J) In chondrogenic differentiation VANGL2 was observed asymmetrically in limited number of cells. In MCAM mutant cell lines (C149, C164, U125) VANGL2 accumulated around the nucleus. (K) Initiation of myogenic (4-day culture with testosterone) & chondrogenic differentiation (4-day culture with BMP2) led to downregulation of ERK1/2 phosphorylation (p-ERK1/2). Instead in MCAM mutant cell lines ERK1/2 phosphorylation increased. Scale bars: 25 µm. Image collected & cropped by CiteAb from the following publication (https://journals.biologists.com/bio/article/doi/10.1242/bio.027771/2567…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PARD3/Par3 Antibody

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] -

Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 is localized asymmetrically at the tip of the cell. (B) The VANGL2 enriched tip of the cell is marked by MSN. (C) In MCAM knockout C164 cells myotube elongation fails, MSN labels the whole plasma membrane & VANGL2 is spread across the cytoplasm. (D) Highly polarized localization of MCAM & SCRIB at the distal end of growing wild-type myotube. Separate channels of the boxed area are shown on the right. (E) In MCAM knockout cells SCRIB levels remain low & it is spread evenly in the cell. (F) In wild-type myotubes PAR3 remains cytoplasmic, whereas (G) in MCAM knockout C164 cells it can be detected at the cell cortex. (H) RT-qPCR demonstrates reduced expression of Scrib in MCAM mutant cell lines. Cells were treated for 7 days with BMP2 or testosterone (n=3; **P<0.01; ***P<0.001; two-tailed t-test; mean±s.e.m.). (I) Deletion of MCAM endocytosis motif leads to similar polarity defects as complete MCAM elimination. VANGL2 is evenly spread in U125 cells & PAR3 accumulates in cell cortex. (J) In chondrogenic differentiation VANGL2 was observed asymmetrically in limited number of cells. In MCAM mutant cell lines (C149, C164, U125) VANGL2 accumulated around the nucleus. (K) Initiation of myogenic (4-day culture with testosterone) & chondrogenic differentiation (4-day culture with BMP2) led to downregulation of ERK1/2 phosphorylation (p-ERK1/2). Instead in MCAM mutant cell lines ERK1/2 phosphorylation increased. Scale bars: 25 µm. Image collected & cropped by CiteAb from the following publication (https://journals.biologists.com/bio/article/doi/10.1242/bio.027771/2567…), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PARD3/Par3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Simple Western

1:100

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:100, apparent MW was 190 kDa

Reviewed Applications

Read 2 reviews rated 4 using NBP1-88861 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARD3/Par3

PARD3 is an adaptor protein involved in asymmetrical cell division and cell polarization processes. PARD3 seems to play a central role in the formation of epithelial tight junctions. PARD3 may affect the quality of hair pigmentation, and act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone (2-3). PARD3 may also play a role in neuroendocrine aspects of melanocortin action, and have a functional role in regulating lipid metabolism in adipocytes (4-5). Recent studies have suggested PARD3 (Par-3) is essential in the formation of myelin sheaths on neuronal axons.

Long Name

Par-3 Partitioning Defective 3 Homolog

Alternate Names

ASIP, Baz, Bazooka, PAR3, PAR3A, SE2-5L16, SE2-5LT1, SE2-5T2

Gene Symbol

PARD3

Additional PARD3/Par3 Products

Product Documents for PARD3/Par3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARD3/Par3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for PARD3/Par3 Antibody - BSA Free

Customer Reviews for PARD3/Par3 Antibody - BSA Free (2)

4 out of 5
2 Customer Ratings
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PARD3/Par3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 22 reviews Showing All
Filter By:
  • Name: enke baldini
    Application: Immunofluorescence
    Sample Tested: cell line derived from anaplastic thyroic cancer
    Species: Human
    Verified Customer | Posted 04/29/2014
    8505C cells (anaplastic thyroid cancer cell line)
    PARD3/Par3 Antibody - BSA Free NBP1-88861
  • Name: Andrew Cosgrove
    Application: Immunocytochemistry
    Sample Tested: Mouse trophoblast stem cells
    Species: Mouse
    Verified Customer | Posted 11/07/2013
    PARD3/Par3 Antibody - BSA Free NBP1-88861

There are no reviews that match your criteria.

Showing  1 - 22 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...