PARP Antibody (2G8N7)

Novus Biologicals | Catalog # NBP3-15802

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2G8N7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PARP (P09874). KLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PARP Antibody (2G8N7)

PARP Antibody (2G8N7)

Immunocytochemistry/ Immunofluorescence: PARP Antibody (2G8N7) [PARP] -

Immunocytochemistry/ Immunofluorescence: PARP Antibody (2G8N7) [PARP] - Immunofluorescence analysis of paraffin-embedded human lung using PARP Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Rat brain using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunocytochemistry/ Immunofluorescence: PARP Antibody (2G8N7) [PARP] -

Immunocytochemistry/ Immunofluorescence: PARP Antibody (2G8N7) [PARP] - Immunofluorescence analysis of HeLa cells using PARP Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Human placenta using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Human spleen using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Human colon using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Rat heart using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PARP Antibody (2G8N7)

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] -

Immunohistochemistry: PARP Antibody (2G8N7) [PARP] - Immunohistochemistry analysis of paraffin-embedded Rat liver using PARP Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for PARP Antibody (2G8N7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PARP

Poly (ADP-ribose) polymerase (PARP) is protein family primarily invloved in DNA repair and programmed cell death. PARP proteins are activated in response to DNA single strand breaks (SSBs). Upon SSB detection, PARP binds the DNA and synthesizes a PAR chain at the damaged site, which then signals the initiation of DNA repair by other enzymes such as XRCC1, DNA ligase III and DNA polymerase beta. After repair, the PAR chains are degraded via PAR glycohydrolase.

PARP is inactivated by caspase cleavage, leading to a programmed cell death pathway.

Long Name

Poly [ADP-ribose] Polymerase

Alternate Names

ADPRT, PARP1, PPOL

Gene Symbol

PARP1

Additional PARP Products

Product Documents for PARP Antibody (2G8N7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARP Antibody (2G8N7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PARP Antibody (2G8N7)

There are currently no reviews for this product. Be the first to review PARP Antibody (2G8N7) and earn rewards!

Have you used PARP Antibody (2G8N7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PARP Antibody (2G8N7)

Showing  1 - 22 FAQs Showing All
  • Q: Do you have any 100 coda or bigger controls?

    A:

    I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

  • Q: Do you have any 100 coda or bigger controls?

    A:

    I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.

  • Q: I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).

    A: For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...